Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78290..78559 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP097662 | ||
| Organism | Klebsiella pneumoniae strain IR12243_1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M3X86_RS27760 | Protein ID | WP_001372321.1 |
| Coordinates | 78434..78559 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 78290..78355 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X86_RS27730 | 74000..74527 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| M3X86_RS27735 | 74585..74818 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| M3X86_RS27740 | 74879..76902 | + | 2024 | Protein_112 | ParB/RepB/Spo0J family partition protein | - |
| M3X86_RS27745 | 76971..77405 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| M3X86_RS27750 | 77402..78121 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 78133..78357 | + | 225 | NuclAT_0 | - | - |
| - | 78133..78357 | + | 225 | NuclAT_0 | - | - |
| - | 78133..78357 | + | 225 | NuclAT_0 | - | - |
| - | 78133..78357 | + | 225 | NuclAT_0 | - | - |
| - | 78290..78355 | - | 66 | - | - | Antitoxin |
| M3X86_RS27755 | 78343..78492 | + | 150 | Protein_115 | plasmid maintenance protein Mok | - |
| M3X86_RS27760 | 78434..78559 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M3X86_RS27765 | 78878..79174 | - | 297 | Protein_117 | hypothetical protein | - |
| M3X86_RS27770 | 79329..80033 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3X86_RS27775 | 80105..80413 | - | 309 | WP_000412447.1 | hypothetical protein | - |
| M3X86_RS27780 | 80440..81432 | - | 993 | WP_000830838.1 | conjugal transfer pilus assembly protein TraU | - |
| M3X86_RS27785 | 81429..82061 | - | 633 | WP_001203735.1 | type-F conjugative transfer system protein TraW | - |
| M3X86_RS27790 | 82058..82444 | - | 387 | WP_015059013.1 | type-F conjugative transfer system protein TrbI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / fosA3 / blaCTX-M-65 / rmtB / blaTEM-1B / blaSHV-12 | - | 1..147322 | 147322 | |
| - | flank | IS/Tn | - | - | 79329..80033 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T245803 WP_001372321.1 NZ_CP097662:78434-78559 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT245803 NZ_CP097662:c78355-78290 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|