Detailed information of TA system TA245803

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 78290..78559
• Replicon: plasmid unnamed2
• Accession: NZ_CP097662
• Organism: Klebsiella pneumoniae strain IR12243_1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M3X86_RS27760
• Protein ID: WP_001372321.1
• Coordinates: 78434..78559 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	78290..78355 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M3X86_RS27730	74000..74527	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
M3X86_RS27735	74585..74818	+	234	WP_000006003.1	DUF905 family protein	-
M3X86_RS27740	74879..76902	+	2024	Protein_112	ParB/RepB/Spo0J family partition protein	-
M3X86_RS27745	76971..77405	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M3X86_RS27750	77402..78121	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	78133..78357	+	225	NuclAT_0	-	-
-	78133..78357	+	225	NuclAT_0	-	-
-	78133..78357	+	225	NuclAT_0	-	-
-	78133..78357	+	225	NuclAT_0	-	-
-	78290..78355	-	66	-	-	Antitoxin
M3X86_RS27755	78343..78492	+	150	Protein_115	plasmid maintenance protein Mok	-
M3X86_RS27760	78434..78559	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M3X86_RS27765	78878..79174	-	297	Protein_117	hypothetical protein	-
M3X86_RS27770	79329..80033	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
M3X86_RS27775	80105..80413	-	309	WP_000412447.1	hypothetical protein	-
M3X86_RS27780	80440..81432	-	993	WP_000830838.1	conjugal transfer pilus assembly protein TraU	-
M3X86_RS27785	81429..82061	-	633	WP_001203735.1	type-F conjugative transfer system protein TraW	-
M3X86_RS27790	82058..82444	-	387	WP_015059013.1	type-F conjugative transfer system protein TrbI	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaKPC-2 / fosA3 / blaCTX-M-65 / rmtB / blaTEM-1B / blaSHV-12	-	1..147322	147322
	-	flank	IS/Tn	-	-	79329..80033	704

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245803 WP_001372321.1 NZ_CP097662:78434-78559 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT245803 NZ_CP097662:c78355-78290 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin