Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 41101..41527 | Replicon | plasmid unnamed1 |
Accession | NZ_CP097659 | ||
Organism | Klebsiella pneumoniae strain IR12099_1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | M3X93_RS26985 | Protein ID | WP_001372321.1 |
Coordinates | 41402..41527 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 41101..41325 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X93_RS26950 (36211) | 36211..36666 | - | 456 | Protein_49 | hypothetical protein | - |
M3X93_RS26955 (36968) | 36968..37495 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
M3X93_RS26960 (37553) | 37553..37786 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
M3X93_RS26965 (37847) | 37847..39870 | + | 2024 | Protein_52 | ParB/RepB/Spo0J family partition protein | - |
M3X93_RS26970 (39939) | 39939..40373 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
M3X93_RS26975 (40370) | 40370..41089 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- (41101) | 41101..41325 | + | 225 | NuclAT_0 | - | Antitoxin |
- (41101) | 41101..41325 | + | 225 | NuclAT_0 | - | Antitoxin |
- (41101) | 41101..41325 | + | 225 | NuclAT_0 | - | Antitoxin |
- (41101) | 41101..41325 | + | 225 | NuclAT_0 | - | Antitoxin |
M3X93_RS26980 (41311) | 41311..41460 | + | 150 | Protein_55 | plasmid maintenance protein Mok | - |
M3X93_RS26985 (41402) | 41402..41527 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
M3X93_RS26990 (41846) | 41846..42142 | - | 297 | Protein_57 | hypothetical protein | - |
M3X93_RS26995 (42442) | 42442..42738 | + | 297 | WP_001272251.1 | hypothetical protein | - |
M3X93_RS27000 (42849) | 42849..43670 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
M3X93_RS27005 (43967) | 43967..44614 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
M3X93_RS27010 (44891) | 44891..45274 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
M3X93_RS27015 (45465) | 45465..46151 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
M3X93_RS27020 (46245) | 46245..46472 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaSHV-12 / blaKPC-2 | - | 1..128678 | 128678 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T245781 WP_001372321.1 NZ_CP097659:41402-41527 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT245781 NZ_CP097659:41101-41325 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|