Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 17760..18013 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097659 | ||
| Organism | Klebsiella pneumoniae strain IR12099_1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M3X93_RS26815 | Protein ID | WP_001312851.1 |
| Coordinates | 17864..18013 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 17760..17819 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3X93_RS26775 (13419) | 13419..13484 | - | 66 | Protein_15 | helix-turn-helix domain-containing protein | - |
| M3X93_RS26780 (13537) | 13537..14241 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M3X93_RS26785 (14266) | 14266..14466 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| M3X93_RS26790 (14486) | 14486..15232 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M3X93_RS26795 (15287) | 15287..15847 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M3X93_RS26800 (15979) | 15979..16179 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| M3X93_RS26805 (16566) | 16566..17165 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M3X93_RS26810 (17227) | 17227..17559 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (17760) | 17760..17819 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (17760) | 17760..17819 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (17760) | 17760..17819 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (17760) | 17760..17819 | - | 60 | NuclAT_1 | - | Antitoxin |
| M3X93_RS26815 (17864) | 17864..18013 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M3X93_RS26820 (18297) | 18297..18545 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M3X93_RS27650 (18790) | 18790..18864 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M3X93_RS26835 (18857) | 18857..19714 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M3X93_RS26840 (20653) | 20653..21306 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M3X93_RS26845 (21399) | 21399..21656 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M3X93_RS26850 (21589) | 21589..21990 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 / blaKPC-2 | - | 1..128678 | 128678 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245778 WP_001312851.1 NZ_CP097659:17864-18013 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245778 NZ_CP097659:c17819-17760 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|