Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 329214..329800 | Replicon | chromosome |
Accession | NZ_CP097658 | ||
Organism | Klebsiella pneumoniae strain IR12099_1 |
Toxin (Protein)
Gene name | doc | Uniprot ID | W8VD46 |
Locus tag | M3X93_RS01530 | Protein ID | WP_002920800.1 |
Coordinates | 329432..329800 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0H3GZM4 |
Locus tag | M3X93_RS01525 | Protein ID | WP_002920802.1 |
Coordinates | 329214..329435 (+) | Length | 74 a.a. |
Genomic Context
Location: 325371..326297 (927 bp)
Type: Others
Protein ID: WP_002920807.1
Type: Others
Protein ID: WP_002920807.1
Location: 326294..327571 (1278 bp)
Type: Others
Protein ID: WP_002920806.1
Type: Others
Protein ID: WP_002920806.1
Location: 327568..328335 (768 bp)
Type: Others
Protein ID: WP_002920803.1
Type: Others
Protein ID: WP_002920803.1
Location: 328337..329050 (714 bp)
Type: Others
Protein ID: WP_004145133.1
Type: Others
Protein ID: WP_004145133.1
Location: 329214..329435 (222 bp)
Type: Antitoxin
Protein ID: WP_002920802.1
Type: Antitoxin
Protein ID: WP_002920802.1
Location: 329432..329800 (369 bp)
Type: Toxin
Protein ID: WP_002920800.1
Type: Toxin
Protein ID: WP_002920800.1
Location: 330072..331388 (1317 bp)
Type: Others
Protein ID: WP_002920796.1
Type: Others
Protein ID: WP_002920796.1
Location: 331495..332382 (888 bp)
Type: Others
Protein ID: WP_002920792.1
Type: Others
Protein ID: WP_002920792.1
Location: 332379..333224 (846 bp)
Type: Others
Protein ID: WP_002920789.1
Type: Others
Protein ID: WP_002920789.1
Location: 333226..334296 (1071 bp)
Type: Others
Protein ID: WP_002920787.1
Type: Others
Protein ID: WP_002920787.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3X93_RS01505 (M3X93_01505) | 325371..326297 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
M3X93_RS01510 (M3X93_01510) | 326294..327571 | + | 1278 | WP_002920806.1 | branched chain amino acid ABC transporter permease LivM | - |
M3X93_RS01515 (M3X93_01515) | 327568..328335 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
M3X93_RS01520 (M3X93_01520) | 328337..329050 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
M3X93_RS01525 (M3X93_01525) | 329214..329435 | + | 222 | WP_002920802.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M3X93_RS01530 (M3X93_01530) | 329432..329800 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
M3X93_RS01535 (M3X93_01535) | 330072..331388 | + | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
M3X93_RS01540 (M3X93_01540) | 331495..332382 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
M3X93_RS01545 (M3X93_01545) | 332379..333224 | + | 846 | WP_002920789.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
M3X93_RS01550 (M3X93_01550) | 333226..334296 | + | 1071 | WP_002920787.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 326294..335033 | 8739 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T245764 WP_002920800.1 NZ_CP097658:329432-329800 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GUD1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZM4 |