Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2854119..2854894 | Replicon | chromosome |
| Accession | NZ_CP097654 | ||
| Organism | Klebsiella pneumoniae strain IR1272_1 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | M3T50_RS13890 | Protein ID | WP_004150910.1 |
| Coordinates | 2854409..2854894 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | M3T50_RS13885 | Protein ID | WP_004150912.1 |
| Coordinates | 2854119..2854412 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3T50_RS13865 (M3T50_13865) | 2849327..2849929 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
| M3T50_RS13870 (M3T50_13870) | 2850027..2850938 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| M3T50_RS13875 (M3T50_13875) | 2850939..2852087 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| M3T50_RS13880 (M3T50_13880) | 2852098..2853474 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| M3T50_RS13885 (M3T50_13885) | 2854119..2854412 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| M3T50_RS13890 (M3T50_13890) | 2854409..2854894 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| M3T50_RS13895 (M3T50_13895) | 2855598..2856191 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| M3T50_RS13900 (M3T50_13900) | 2856288..2856504 | + | 217 | Protein_2700 | transposase | - |
| M3T50_RS13905 (M3T50_13905) | 2857110..2857982 | + | 873 | WP_004188557.1 | ParA family protein | - |
| M3T50_RS13910 (M3T50_13910) | 2857982..2858365 | + | 384 | WP_004150906.1 | hypothetical protein | - |
| M3T50_RS13915 (M3T50_13915) | 2858358..2859725 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2856288..2856440 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T245750 WP_004150910.1 NZ_CP097654:2854409-2854894 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |