Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2438197..2438783 Replicon chromosome
Accession NZ_CP097654
Organism Klebsiella pneumoniae strain IR1272_1

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M3T50_RS11705 Protein ID WP_002920800.1
Coordinates 2438415..2438783 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag M3T50_RS11700 Protein ID WP_002920802.1
Coordinates 2438197..2438418 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3T50_RS11680 (M3T50_11680) 2434354..2435280 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M3T50_RS11685 (M3T50_11685) 2435277..2436554 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
M3T50_RS11690 (M3T50_11690) 2436551..2437318 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M3T50_RS11695 (M3T50_11695) 2437320..2438033 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M3T50_RS11700 (M3T50_11700) 2438197..2438418 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M3T50_RS11705 (M3T50_11705) 2438415..2438783 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M3T50_RS11710 (M3T50_11710) 2439056..2440372 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M3T50_RS11715 (M3T50_11715) 2440479..2441366 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M3T50_RS11720 (M3T50_11720) 2441363..2442208 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M3T50_RS11725 (M3T50_11725) 2442210..2443280 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2435277..2444017 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T245748 WP_002920800.1 NZ_CP097654:2438415-2438783 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT245748 WP_002920802.1 NZ_CP097654:2438197-2438418 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References