Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 35471..36198 | Replicon | plasmid unnamed |
| Accession | NZ_CP097652 | ||
| Organism | Klebsiella pneumoniae strain NK01067 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | M8Y62_RS26100 | Protein ID | WP_011251285.1 |
| Coordinates | 35471..35782 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M8Y62_RS26105 | Protein ID | WP_011251286.1 |
| Coordinates | 35779..36198 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Y62_RS26075 (M8Y62_26075) | 30990..31484 | - | 495 | WP_004212794.1 | thermonuclease family protein | - |
| M8Y62_RS26080 (M8Y62_26080) | 31662..31928 | + | 267 | WP_223175074.1 | DUF1173 family protein | - |
| M8Y62_RS26085 (M8Y62_26085) | 31919..32611 | + | 693 | WP_011154578.1 | DUF1173 family protein | - |
| M8Y62_RS26095 (M8Y62_26095) | 34829..35266 | + | 438 | Protein_41 | DDE-type integrase/transposase/recombinase | - |
| M8Y62_RS26100 (M8Y62_26100) | 35471..35782 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| M8Y62_RS26105 (M8Y62_26105) | 35779..36198 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M8Y62_RS26110 (M8Y62_26110) | 36345..37313 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| M8Y62_RS26115 (M8Y62_26115) | 37385..37750 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| M8Y62_RS26120 (M8Y62_26120) | 37764..38552 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| M8Y62_RS26125 (M8Y62_26125) | 38573..39193 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| M8Y62_RS26130 (M8Y62_26130) | 39612..40247 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| M8Y62_RS26135 (M8Y62_26135) | 40560..41030 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB | 1..232508 | 232508 | |
| - | inside | IScluster/Tn | - | - | 33997..46319 | 12322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T245740 WP_011251285.1 NZ_CP097652:35471-35782 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT245740 WP_011251286.1 NZ_CP097652:35779-36198 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|