Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 327688..328274 Replicon chromosome
Accession NZ_CP097651
Organism Klebsiella pneumoniae strain NK01067

Toxin (Protein)


Gene name doc Uniprot ID A0A330WAT7
Locus tag M8Y62_RS01525 Protein ID WP_014906830.1
Coordinates 327906..328274 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M8Y62_RS01520 Protein ID WP_004174006.1
Coordinates 327688..327909 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y62_RS01500 (323845) 323845..324771 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M8Y62_RS01505 (324768) 324768..326045 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M8Y62_RS01510 (326042) 326042..326809 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M8Y62_RS01515 (326811) 326811..327524 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M8Y62_RS01520 (327688) 327688..327909 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M8Y62_RS01525 (327906) 327906..328274 + 369 WP_014906830.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M8Y62_RS01530 (328547) 328547..329863 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M8Y62_RS01535 (329970) 329970..330857 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M8Y62_RS01540 (330854) 330854..331699 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M8Y62_RS01545 (331701) 331701..332771 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 324768..333508 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(28-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13537.95 Da        Isoelectric Point: 8.6410

>T245728 WP_014906830.1 NZ_CP097651:327906-328274 [Klebsiella pneumoniae]
MTLQIISAEEIILFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT245728 WP_004174006.1 NZ_CP097651:327688-327909 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A330WAT7

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References