Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3754093..3754690 | Replicon | chromosome |
| Accession | NZ_CP097646 | ||
| Organism | Klebsiella quasipneumoniae strain NE1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M8232_RS18210 | Protein ID | WP_108450630.1 |
| Coordinates | 3754373..3754690 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M8232_RS18205 | Protein ID | WP_108450629.1 |
| Coordinates | 3754093..3754380 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8232_RS18175 (3750180) | 3750180..3750428 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| M8232_RS18180 (3750446) | 3750446..3750787 | - | 342 | WP_004202492.1 | RamA family antibiotic efflux transcriptional regulator | - |
| M8232_RS18185 (3750818) | 3750818..3751933 | - | 1116 | WP_025999133.1 | MBL fold metallo-hydrolase | - |
| M8232_RS18190 (3752113) | 3752113..3752694 | + | 582 | WP_017899014.1 | TetR/AcrR family transcriptional regulator | - |
| M8232_RS18195 (3752694) | 3752694..3753062 | + | 369 | WP_004202487.1 | MmcQ/YjbR family DNA-binding protein | - |
| M8232_RS18200 (3753182) | 3753182..3753835 | + | 654 | WP_108450628.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| M8232_RS18205 (3754093) | 3754093..3754380 | - | 288 | WP_108450629.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M8232_RS18210 (3754373) | 3754373..3754690 | - | 318 | WP_108450630.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8232_RS18215 (3754875) | 3754875..3755918 | - | 1044 | WP_060656299.1 | hypothetical protein | - |
| M8232_RS18220 (3756456) | 3756456..3757322 | - | 867 | WP_158239951.1 | helix-turn-helix transcriptional regulator | - |
| M8232_RS18225 (3757431) | 3757431..3758858 | + | 1428 | WP_023319904.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12197.57 Da Isoelectric Point: 11.2767
>T245716 WP_108450630.1 NZ_CP097646:c3754690-3754373 [Klebsiella quasipneumoniae]
MFRMVVHVDVKKELQALPAIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQNKTLFLLRVF
VKKTQKIPLSEIRLALKRLEEMRNE
MFRMVVHVDVKKELQALPAIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQNKTLFLLRVF
VKKTQKIPLSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|