Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 1533318..1533891 | Replicon | chromosome |
| Accession | NZ_CP097635 | ||
| Organism | Aquincola tertiaricarbonis strain RN12 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | MW290_RS07085 | Protein ID | WP_250196549.1 |
| Coordinates | 1533318..1533617 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MW290_RS07090 | Protein ID | WP_250196550.1 |
| Coordinates | 1533604..1533891 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MW290_RS07060 (MW290_07060) | 1528679..1529419 | - | 741 | WP_250196544.1 | HisA/HisF-related TIM barrel protein | - |
| MW290_RS07065 (MW290_07065) | 1529432..1530367 | + | 936 | WP_250196545.1 | ATP-grasp domain-containing protein | - |
| MW290_RS07070 (MW290_07070) | 1530360..1531448 | + | 1089 | WP_250196546.1 | hydantoinase/oxoprolinase family protein | - |
| MW290_RS07075 (MW290_07075) | 1531449..1532048 | + | 600 | WP_250196547.1 | aspartate kinase | - |
| MW290_RS07080 (MW290_07080) | 1532230..1533210 | + | 981 | WP_250196548.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| MW290_RS07085 (MW290_07085) | 1533318..1533617 | + | 300 | WP_250196549.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MW290_RS07090 (MW290_07090) | 1533604..1533891 | + | 288 | WP_250196550.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| MW290_RS07095 (MW290_07095) | 1533907..1535370 | - | 1464 | WP_250196551.1 | glucose-6-phosphate dehydrogenase | - |
| MW290_RS07100 (MW290_07100) | 1535584..1537686 | + | 2103 | WP_250196552.1 | elongation factor G | - |
| MW290_RS07105 (MW290_07105) | 1537766..1538485 | + | 720 | WP_250196553.1 | protein N-lysine methyltransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11196.27 Da Isoelectric Point: 11.0232
>T245702 WP_250196549.1 NZ_CP097635:1533318-1533617 [Aquincola tertiaricarbonis]
VVEEILALPDTLAARYVVLTRRIMAVGPNLGAPHTDAFGEGLFELRLKGQEGIARVFFCALVGRRVMMLHSFIKKTQRTP
QREIEVARKRMKEVKHANP
VVEEILALPDTLAARYVVLTRRIMAVGPNLGAPHTDAFGEGLFELRLKGQEGIARVFFCALVGRRVMMLHSFIKKTQRTP
QREIEVARKRMKEVKHANP
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|