Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 136471..136724 | Replicon | plasmid pKPC2_140253 |
| Accession | NZ_CP097627 | ||
| Organism | Klebsiella pneumoniae strain 140253 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M9P58_RS27850 | Protein ID | WP_001312851.1 |
| Coordinates | 136471..136620 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 136665..136724 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9P58_RS27810 (131830) | 131830..132245 | - | 416 | Protein_171 | IS1-like element IS1B family transposase | - |
| M9P58_RS27815 (132494) | 132494..132895 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M9P58_RS27820 (132828) | 132828..133085 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M9P58_RS27825 (133178) | 133178..133831 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M9P58_RS27830 (134770) | 134770..135627 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| M9P58_RS29525 (135620) | 135620..135694 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| M9P58_RS27845 (135939) | 135939..136187 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| M9P58_RS27850 (136471) | 136471..136620 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (136665) | 136665..136724 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (136665) | 136665..136724 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (136665) | 136665..136724 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (136665) | 136665..136724 | + | 60 | NuclAT_1 | - | Antitoxin |
| M9P58_RS27855 (136925) | 136925..137257 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| M9P58_RS27860 (137319) | 137319..137918 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| M9P58_RS27865 (138304) | 138304..138504 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| M9P58_RS27870 (138636) | 138636..139196 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| M9P58_RS27875 (139251) | 139251..139997 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| M9P58_RS27880 (140017) | 140017..140217 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| M9P58_RS27885 (140242) | 140242..140946 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M9P58_RS27890 (140999) | 140999..141064 | + | 66 | Protein_186 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155793 | 155793 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T245691 WP_001312851.1 NZ_CP097627:c136620-136471 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT245691 NZ_CP097627:136665-136724 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|