Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1847069..1847674 | Replicon | chromosome |
| Accession | NZ_CP097576 | ||
| Organism | Microcystis aeruginosa str. Chao 1910 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M8120_RS09275 | Protein ID | WP_190358824.1 |
| Coordinates | 1847393..1847674 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M8120_RS09270 | Protein ID | WP_190358823.1 |
| Coordinates | 1847069..1847383 (-) | Length | 105 a.a. |
Genomic Context
Location: 1842711..1843802 (1092 bp)
Type: Others
Protein ID: WP_265795848.1
Type: Others
Protein ID: WP_265795848.1
Location: 1848315..1848575 (261 bp)
Type: Others
Protein ID: WP_002740817.1
Type: Others
Protein ID: WP_002740817.1
Location: 1848562..1848984 (423 bp)
Type: Others
Protein ID: WP_190358826.1
Type: Others
Protein ID: WP_190358826.1
Location: 1844253..1846409 (2157 bp)
Type: Others
Protein ID: Protein_1835
Type: Others
Protein ID: Protein_1835
Location: 1846559..1846900 (342 bp)
Type: Others
Protein ID: WP_242030171.1
Type: Others
Protein ID: WP_242030171.1
Location: 1847069..1847383 (315 bp)
Type: Antitoxin
Protein ID: WP_190358823.1
Type: Antitoxin
Protein ID: WP_190358823.1
Location: 1847393..1847674 (282 bp)
Type: Toxin
Protein ID: WP_190358824.1
Type: Toxin
Protein ID: WP_190358824.1
Location: 1847980..1848132 (153 bp)
Type: Others
Protein ID: WP_190358825.1
Type: Others
Protein ID: WP_190358825.1
Location: 1849096..1849377 (282 bp)
Type: Others
Protein ID: WP_002736843.1
Type: Others
Protein ID: WP_002736843.1
Location: 1849558..1852077 (2520 bp)
Type: Others
Protein ID: WP_190358827.1
Type: Others
Protein ID: WP_190358827.1
Location: 1852276..1852569 (294 bp)
Type: Others
Protein ID: WP_190358828.1
Type: Others
Protein ID: WP_190358828.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8120_RS09255 (M8120_09160) | 1842711..1843802 | + | 1092 | WP_265795848.1 | ISAs1 family transposase | - |
| M8120_RS09260 (M8120_09165) | 1844253..1846409 | - | 2157 | Protein_1835 | tetratricopeptide repeat protein | - |
| M8120_RS09265 (M8120_09170) | 1846559..1846900 | - | 342 | WP_242030171.1 | hypothetical protein | - |
| M8120_RS09270 (M8120_09175) | 1847069..1847383 | - | 315 | WP_190358823.1 | HigA family addiction module antitoxin | Antitoxin |
| M8120_RS09275 (M8120_09180) | 1847393..1847674 | - | 282 | WP_190358824.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8120_RS09280 (M8120_09185) | 1847980..1848132 | - | 153 | WP_190358825.1 | hypothetical protein | - |
| M8120_RS09285 (M8120_09190) | 1848315..1848575 | + | 261 | WP_002740817.1 | hypothetical protein | - |
| M8120_RS09290 (M8120_09195) | 1848562..1848984 | + | 423 | WP_190358826.1 | type II toxin-antitoxin system VapC family toxin | - |
| M8120_RS09295 (M8120_09200) | 1849096..1849377 | - | 282 | WP_002736843.1 | hemolysin XhlA family protein | - |
| M8120_RS09300 (M8120_09205) | 1849558..1852077 | - | 2520 | WP_190358827.1 | glycogen/starch/alpha-glucan phosphorylase | - |
| M8120_RS09305 (M8120_09210) | 1852276..1852569 | - | 294 | WP_190358828.1 | RNA-binding protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11085.68 Da Isoelectric Point: 9.7184
>T245622 WP_190358824.1 NZ_CP097576:c1847674-1847393 [Microcystis aeruginosa str. Chao 1910]
VIQNFKDKEAQKVFERKHSRKLPLDIQQVALRKLRMLNRAETLQDLRVPPANRLERLVGDREGQYSIRVNDQWRICFVWQ
NGDALDGEIVDYH
VIQNFKDKEAQKVFERKHSRKLPLDIQQVALRKLRMLNRAETLQDLRVPPANRLERLVGDREGQYSIRVNDQWRICFVWQ
NGDALDGEIVDYH
Download Length: 282 bp
Antitoxin
Download Length: 105 a.a. Molecular weight: 11802.77 Da Isoelectric Point: 4.2285
>AT245622 WP_190358823.1 NZ_CP097576:c1847383-1847069 [Microcystis aeruginosa str. Chao 1910]
MNEDKLMPIHPGEVLLEEFIKPMNLSQNQIALALGVPEQCINEIVHGKRCITADIALRLARYFDMSPRFWLGLQMDYDLD
VVEDEIGDQLAKEVAVMTVICAEK
MNEDKLMPIHPGEVLLEEFIKPMNLSQNQIALALGVPEQCINEIVHGKRCITADIALRLARYFDMSPRFWLGLQMDYDLD
VVEDEIGDQLAKEVAVMTVICAEK
Download Length: 315 bp