Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
| Location | 1208961..1209480 | Replicon | chromosome |
| Accession | NZ_CP097576 | ||
| Organism | Microcystis aeruginosa str. Chao 1910 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | M8120_RS05985 | Protein ID | WP_190357430.1 |
| Coordinates | 1209214..1209480 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | M8120_RS05980 | Protein ID | WP_190357429.1 |
| Coordinates | 1208961..1209221 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8120_RS05950 (M8120_05905) | 1204379..1204834 | + | 456 | WP_242030049.1 | hypothetical protein | - |
| M8120_RS05955 (M8120_05910) | 1204905..1205135 | + | 231 | WP_256094039.1 | HNH endonuclease signature motif containing protein | - |
| M8120_RS05960 (M8120_05915) | 1205128..1206168 | - | 1041 | WP_190357426.1 | DNA (cytosine-5-)-methyltransferase | - |
| M8120_RS05965 (M8120_05920) | 1206469..1207506 | + | 1038 | WP_190357427.1 | fatty acid desaturase | - |
| M8120_RS05970 (M8120_05925) | 1207899..1208162 | + | 264 | WP_190357428.1 | hypothetical protein | - |
| M8120_RS05975 (M8120_05930) | 1208163..1208630 | + | 468 | WP_045362300.1 | type II toxin-antitoxin system VapC family toxin | - |
| M8120_RS05980 (M8120_05935) | 1208961..1209221 | + | 261 | WP_190357429.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M8120_RS05985 (M8120_05940) | 1209214..1209480 | + | 267 | WP_190357430.1 | Txe/YoeB family addiction module toxin | Toxin |
| M8120_RS05990 (M8120_05945) | 1209745..1210089 | - | 345 | WP_190357431.1 | DUF86 domain-containing protein | - |
| M8120_RS05995 (M8120_05950) | 1210086..1210379 | - | 294 | WP_002783391.1 | nucleotidyltransferase family protein | - |
| M8120_RS06000 (M8120_05955) | 1210578..1211405 | - | 828 | WP_242030050.1 | PEP-CTERM sorting domain-containing protein | - |
| M8120_RS06005 (M8120_05960) | 1211700..1211945 | + | 246 | WP_002734321.1 | hypothetical protein | - |
| M8120_RS06010 (M8120_05965) | 1211938..1212147 | + | 210 | WP_002798168.1 | hypothetical protein | - |
| M8120_RS06015 (M8120_05970) | 1212350..1212802 | - | 453 | WP_002750618.1 | PIN domain-containing protein | - |
| M8120_RS06020 (M8120_05975) | 1212802..1213038 | - | 237 | WP_008202209.1 | hypothetical protein | - |
| M8120_RS06025 (M8120_05980) | 1213265..1213525 | + | 261 | WP_242030051.1 | HigA family addiction module antitoxin | - |
| M8120_RS06030 (M8120_05985) | 1213591..1214026 | - | 436 | Protein_1197 | IS200/IS605 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1208163..1222028 | 13865 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10485.16 Da Isoelectric Point: 9.9458
>T245619 WP_190357430.1 NZ_CP097576:1209214-1209480 [Microcystis aeruginosa str. Chao 1910]
MDNWQLVFTKQAKKDAEKLARTGLAKQANELLNILKSNPYQSYPVYEKLSGDLASYYSRRINIQHRLVYQVIPEEKVVKI
IRMWIHYE
MDNWQLVFTKQAKKDAEKLARTGLAKQANELLNILKSNPYQSYPVYEKLSGDLASYYSRRINIQHRLVYQVIPEEKVVKI
IRMWIHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|