Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 2342690..2343285 | Replicon | chromosome |
Accession | NZ_CP097575 | ||
Organism | Pseudomonas aeruginosa strain UNC_PaerCF25 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | M9A05_RS10750 | Protein ID | WP_003113526.1 |
Coordinates | 2343007..2343285 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M9A05_RS10745 | Protein ID | WP_003099268.1 |
Coordinates | 2342690..2342995 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9A05_RS10710 (M9A05_10710) | 2337830..2338678 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
M9A05_RS10720 (M9A05_10720) | 2338845..2339786 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
M9A05_RS10725 (M9A05_10725) | 2339903..2340517 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
M9A05_RS10730 (M9A05_10730) | 2340559..2341143 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
M9A05_RS10735 (M9A05_10735) | 2341184..2342284 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
M9A05_RS10745 (M9A05_10745) | 2342690..2342995 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
M9A05_RS10750 (M9A05_10750) | 2343007..2343285 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9A05_RS10755 (M9A05_10755) | 2343338..2343466 | - | 129 | Protein_2130 | integrase | - |
M9A05_RS10760 (M9A05_10760) | 2343614..2345842 | + | 2229 | WP_250177723.1 | TonB-dependent receptor | - |
M9A05_RS10765 (M9A05_10765) | 2345912..2346559 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M9A05_RS10770 (M9A05_10770) | 2346621..2347859 | - | 1239 | WP_003111578.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T245614 WP_003113526.1 NZ_CP097575:c2343285-2343007 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|