Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1220685..1221334 | Replicon | chromosome |
Accession | NZ_CP097572 | ||
Organism | Enterobacter kobei strain C210239 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2J0PLQ3 |
Locus tag | M8978_RS05695 | Protein ID | WP_014882864.1 |
Coordinates | 1220972..1221334 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2W0GCS7 |
Locus tag | M8978_RS05690 | Protein ID | WP_014882863.1 |
Coordinates | 1220685..1220984 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8978_RS05680 (M8978_05680) | 1217110..1219083 | + | 1974 | WP_023336850.1 | PhoX family phosphatase | - |
M8978_RS05685 (M8978_05685) | 1219186..1220574 | + | 1389 | WP_014882862.1 | phenylalanine transporter | - |
M8978_RS05690 (M8978_05690) | 1220685..1220984 | - | 300 | WP_014882863.1 | helix-turn-helix transcriptional regulator | Antitoxin |
M8978_RS05695 (M8978_05695) | 1220972..1221334 | - | 363 | WP_014882864.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M8978_RS05700 (M8978_05700) | 1221540..1222775 | + | 1236 | WP_023332295.1 | MFS transporter | - |
M8978_RS05705 (M8978_05705) | 1222791..1223816 | + | 1026 | WP_059372448.1 | sugar phosphate isomerase/epimerase family protein | - |
M8978_RS05710 (M8978_05710) | 1223809..1224951 | + | 1143 | WP_059372452.1 | Gfo/Idh/MocA family oxidoreductase | - |
M8978_RS05715 (M8978_05715) | 1225027..1225998 | + | 972 | WP_047626963.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13952.92 Da Isoelectric Point: 6.7114
>T245604 WP_014882864.1 NZ_CP097572:c1221334-1220972 [Enterobacter kobei]
MWNVETTDRFDQWYFEQTTALKEDVLAMMHILAEFGPTLGRPYVDTVKASAYANMKELRIQHAGNPIRAFFAFDPDRKAI
VLCAGNKTGCNQKRFYNEMITLADVEYSRHLADKEAIWQR
MWNVETTDRFDQWYFEQTTALKEDVLAMMHILAEFGPTLGRPYVDTVKASAYANMKELRIQHAGNPIRAFFAFDPDRKAI
VLCAGNKTGCNQKRFYNEMITLADVEYSRHLADKEAIWQR
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0PLQ3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W0GCS7 |