Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2484992..2485176 | Replicon | chromosome |
Accession | NZ_CP097571 | ||
Organism | Staphylococcus aureus strain V40 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | M8789_RS12400 | Protein ID | WP_000482647.1 |
Coordinates | 2485069..2485176 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2484992..2485052 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8789_RS12385 | 2480446..2480613 | - | 168 | WP_031927726.1 | hypothetical protein | - |
M8789_RS12390 | 2480844..2482577 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein | - |
M8789_RS12395 | 2482602..2484365 | - | 1764 | WP_001064840.1 | ABC transporter ATP-binding protein | - |
- | 2484992..2485052 | + | 61 | - | - | Antitoxin |
M8789_RS12400 | 2485069..2485176 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
M8789_RS12405 | 2485310..2485696 | - | 387 | WP_000779353.1 | flippase GtxA | - |
M8789_RS12410 | 2485964..2487106 | + | 1143 | WP_001176867.1 | glycerate kinase | - |
M8789_RS12415 | 2487166..2487825 | + | 660 | WP_000831298.1 | membrane protein | - |
M8789_RS12420 | 2488008..2489219 | + | 1212 | WP_001191927.1 | multidrug effflux MFS transporter | - |
M8789_RS12425 | 2489342..2489815 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T245598 WP_000482647.1 NZ_CP097571:c2485176-2485069 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT245598 NZ_CP097571:2484992-2485052 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|