245593

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1543355..1543769 Replicon chromosome
Accession NZ_CP097571
Organism Staphylococcus aureus strain V40

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M8789_RS07355 Protein ID WP_001065074.1
Coordinates 1543518..1543769 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag M8789_RS07350 Protein ID WP_000028424.1
Coordinates 1543355..1543528 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8789_RS07305 (1538754) 1538754..1538858 + 105 WP_078103314.1 hypothetical protein -
M8789_RS07310 (1538961) 1538961..1541408 - 2448 WP_044122784.1 virulence-associated E family protein -
M8789_RS07315 (1541461) 1541461..1541661 - 201 WP_000265251.1 DUF1514 family protein -
M8789_RS07320 (1541729) 1541729..1541881 - 153 WP_000595260.1 transcriptional activator RinB -
M8789_RS07325 (1541878) 1541878..1542084 - 207 WP_000195803.1 DUF1381 domain-containing protein -
M8789_RS07330 (1542081) 1542081..1542326 - 246 WP_001282074.1 hypothetical protein -
M8789_RS07335 (1542363) 1542363..1542896 - 534 WP_031904153.1 dUTPase -
M8789_RS07340 (1542911) 1542911..1543072 - 162 WP_000889682.1 hypothetical protein -
M8789_RS07345 (1543073) 1543073..1543354 - 282 WP_250164252.1 hypothetical protein -
M8789_RS07350 (1543355) 1543355..1543528 - 174 WP_000028424.1 hypothetical protein Antitoxin
M8789_RS07355 (1543518) 1543518..1543769 - 252 WP_001065074.1 DUF1024 family protein Toxin
M8789_RS07360 (1543762) 1543762..1544046 - 285 WP_001105603.1 hypothetical protein -
M8789_RS07365 (1544043) 1544043..1544480 - 438 WP_044122119.1 YopX family protein -
M8789_RS07370 (1544477) 1544477..1544671 - 195 WP_000983952.1 hypothetical protein -
M8789_RS07375 (1544668) 1544668..1545093 - 426 WP_044122121.1 hypothetical protein -
M8789_RS07380 (1545106) 1545106..1545354 - 249 WP_135789263.1 SAV1978 family virulence-associated passenger protein -
M8789_RS07385 (1545354) 1545354..1545608 - 255 WP_250164253.1 DUF3310 domain-containing protein -
M8789_RS07390 (1545608) 1545608..1546009 - 402 WP_000113977.1 PVL family protein -
M8789_RS07395 (1546009) 1546009..1546194 - 186 WP_001164629.1 DUF3113 family protein -
M8789_RS07400 (1546207) 1546207..1548159 - 1953 WP_250164473.1 DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - see 1508872..1573695 64823


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9513.41 Da        Isoelectric Point: 3.7128

>T245593 WP_001065074.1 NZ_CP097571:c1543769-1543518 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIYLDEAVGIMTSQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT245593 WP_000028424.1 NZ_CP097571:c1543528-1543355 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References