Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprG-sprF/-
Location 1512567..1512793 Replicon chromosome
Accession NZ_CP097571
Organism Staphylococcus aureus strain V40

Toxin (Protein)


Gene name SprG3 Uniprot ID -
Locus tag M8789_RS07165 Protein ID WP_044122766.1
Coordinates 1512689..1512793 (-) Length 35 a.a.

Antitoxin (RNA)


Gene name SprF2
Locus tag -
Coordinates 1512567..1512660 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8789_RS07130 (1507713) 1507713..1508258 - 546 WP_001186907.1 ECF transporter S component -
M8789_RS07135 (1508537) 1508537..1508667 - 131 Protein_1398 hypothetical protein -
M8789_RS07140 (1508872) 1508872..1509780 - 909 Protein_1399 DUF1672 domain-containing protein -
M8789_RS07145 (1509872) 1509872..1510057 - 186 WP_000470336.1 hypothetical protein -
M8789_RS07150 (1510624) 1510624..1512069 - 1446 Protein_1401 SH3 domain-containing protein -
M8789_RS07155 (1512050) 1512050..1512487 - 438 WP_044122765.1 phage holin -
M8789_RS07160 (1512538) 1512538..1512633 + 96 Protein_1403 hypothetical protein -
- (1512567) 1512567..1512660 + 94 NuclAT_0 - Antitoxin
- (1512567) 1512567..1512660 + 94 NuclAT_0 - Antitoxin
- (1512567) 1512567..1512660 + 94 NuclAT_0 - Antitoxin
- (1512567) 1512567..1512660 + 94 NuclAT_0 - Antitoxin
M8789_RS07165 (1512689) 1512689..1512793 - 105 WP_044122766.1 hypothetical protein Toxin
M8789_RS07170 (1513050) 1513050..1513823 - 774 WP_250164248.1 staphylococcal enterotoxin type E -
M8789_RS07175 (1514255) 1514255..1514554 - 300 WP_044122768.1 DUF2951 domain-containing protein -
M8789_RS07180 (1514600) 1514600..1514764 - 165 WP_016187456.1 XkdX family protein -
M8789_RS07185 (1514757) 1514757..1515146 - 390 WP_044122770.1 DUF2977 domain-containing protein -
M8789_RS07190 (1515146) 1515146..1516612 - 1467 WP_044122772.1 BppU family phage baseplate upper protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - see 1508872..1573695 64823


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 35 a.a.        Molecular weight: 3932.77 Da        Isoelectric Point: 5.5724

>T245590 WP_044122766.1 NZ_CP097571:c1512793-1512689 [Staphylococcus aureus]
MLLLERNSMSDFEMLMVVLTIIGLVLISNQDHKK

Download         Length: 105 bp

Antitoxin


Download         Length: 94 bp

>AT245590 NZ_CP097571:1512567-1512660 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTTTTCATAGAAAAA
TTATAAAAATAACC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References