Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1512567..1512793 | Replicon | chromosome |
Accession | NZ_CP097571 | ||
Organism | Staphylococcus aureus strain V40 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | M8789_RS07165 | Protein ID | WP_044122766.1 |
Coordinates | 1512689..1512793 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 1512567..1512660 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8789_RS07130 (1507713) | 1507713..1508258 | - | 546 | WP_001186907.1 | ECF transporter S component | - |
M8789_RS07135 (1508537) | 1508537..1508667 | - | 131 | Protein_1398 | hypothetical protein | - |
M8789_RS07140 (1508872) | 1508872..1509780 | - | 909 | Protein_1399 | DUF1672 domain-containing protein | - |
M8789_RS07145 (1509872) | 1509872..1510057 | - | 186 | WP_000470336.1 | hypothetical protein | - |
M8789_RS07150 (1510624) | 1510624..1512069 | - | 1446 | Protein_1401 | SH3 domain-containing protein | - |
M8789_RS07155 (1512050) | 1512050..1512487 | - | 438 | WP_044122765.1 | phage holin | - |
M8789_RS07160 (1512538) | 1512538..1512633 | + | 96 | Protein_1403 | hypothetical protein | - |
- (1512567) | 1512567..1512660 | + | 94 | NuclAT_0 | - | Antitoxin |
- (1512567) | 1512567..1512660 | + | 94 | NuclAT_0 | - | Antitoxin |
- (1512567) | 1512567..1512660 | + | 94 | NuclAT_0 | - | Antitoxin |
- (1512567) | 1512567..1512660 | + | 94 | NuclAT_0 | - | Antitoxin |
M8789_RS07165 (1512689) | 1512689..1512793 | - | 105 | WP_044122766.1 | hypothetical protein | Toxin |
M8789_RS07170 (1513050) | 1513050..1513823 | - | 774 | WP_250164248.1 | staphylococcal enterotoxin type E | - |
M8789_RS07175 (1514255) | 1514255..1514554 | - | 300 | WP_044122768.1 | DUF2951 domain-containing protein | - |
M8789_RS07180 (1514600) | 1514600..1514764 | - | 165 | WP_016187456.1 | XkdX family protein | - |
M8789_RS07185 (1514757) | 1514757..1515146 | - | 390 | WP_044122770.1 | DUF2977 domain-containing protein | - |
M8789_RS07190 (1515146) | 1515146..1516612 | - | 1467 | WP_044122772.1 | BppU family phage baseplate upper protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | see | 1508872..1573695 | 64823 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3932.77 Da Isoelectric Point: 5.5724
>T245590 WP_044122766.1 NZ_CP097571:c1512793-1512689 [Staphylococcus aureus]
MLLLERNSMSDFEMLMVVLTIIGLVLISNQDHKK
MLLLERNSMSDFEMLMVVLTIIGLVLISNQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 94 bp
>AT245590 NZ_CP097571:1512567-1512660 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTTTTCATAGAAAAA
TTATAAAAATAACC
ATATATAGAAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTTTTCATAGAAAAA
TTATAAAAATAACC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|