Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6220731..6221326 | Replicon | chromosome |
Accession | NZ_CP097560 | ||
Organism | Pseudomonas aeruginosa strain C4.2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PAC42_RS29945 | Protein ID | WP_003113526.1 |
Coordinates | 6221048..6221326 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PAC42_RS29940 | Protein ID | WP_003099268.1 |
Coordinates | 6220731..6221036 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAC42_RS29905 (PAC42_29825) | 6215882..6216730 | + | 849 | WP_003146058.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PAC42_RS29915 (PAC42_29835) | 6216897..6217838 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PAC42_RS29920 (PAC42_29840) | 6217955..6218569 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PAC42_RS29925 (PAC42_29845) | 6218611..6219195 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PAC42_RS29930 (PAC42_29850) | 6219236..6220336 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PAC42_RS29940 (PAC42_29860) | 6220731..6221036 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PAC42_RS29945 (PAC42_29865) | 6221048..6221326 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAC42_RS29950 (PAC42_29870) | 6221379..6221507 | - | 129 | Protein_5921 | integrase | - |
PAC42_RS29955 (PAC42_29875) | 6221655..6223883 | + | 2229 | WP_023108789.1 | TonB-dependent receptor | - |
PAC42_RS29960 (PAC42_29880) | 6223953..6224600 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PAC42_RS29965 (PAC42_29885) | 6224662..6225900 | - | 1239 | WP_023108790.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T245587 WP_003113526.1 NZ_CP097560:c6221326-6221048 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|