Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5320455..5321050 | Replicon | chromosome |
| Accession | NZ_CP097556 | ||
| Organism | Pseudomonas aeruginosa strain B2.1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | M8Z96_RS24760 | Protein ID | WP_003113526.1 |
| Coordinates | 5320772..5321050 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M8Z96_RS24755 | Protein ID | WP_003133769.1 |
| Coordinates | 5320455..5320760 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Z96_RS24725 (M8Z96_24700) | 5315825..5316097 | + | 273 | WP_071538125.1 | DNA-binding protein | - |
| M8Z96_RS24730 (M8Z96_24705) | 5316155..5316736 | + | 582 | WP_123903235.1 | sce7726 family protein | - |
| M8Z96_RS24735 (M8Z96_24710) | 5316723..5317793 | - | 1071 | WP_023098928.1 | beta family protein | - |
| M8Z96_RS24740 (M8Z96_24715) | 5317783..5318619 | - | 837 | WP_079387117.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M8Z96_RS24745 (M8Z96_24720) | 5318612..5319286 | - | 675 | WP_023098926.1 | N-acetyltransferase | - |
| M8Z96_RS24750 (M8Z96_24725) | 5319712..5320119 | - | 408 | WP_049267485.1 | hypothetical protein | - |
| M8Z96_RS24755 (M8Z96_24730) | 5320455..5320760 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| M8Z96_RS24760 (M8Z96_24735) | 5320772..5321050 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8Z96_RS24765 (M8Z96_24740) | 5321103..5321231 | - | 129 | Protein_4891 | integrase | - |
| M8Z96_RS24770 (M8Z96_24745) | 5321379..5323607 | + | 2229 | WP_043089846.1 | TonB-dependent receptor | - |
| M8Z96_RS24775 (M8Z96_24750) | 5323677..5324324 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| M8Z96_RS24780 (M8Z96_24755) | 5324386..5325624 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10614.13 Da Isoelectric Point: 7.8937
>T245574 WP_003113526.1 NZ_CP097556:c5321050-5320772 [Pseudomonas aeruginosa]
VILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
VILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|