Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5320468..5321063 | Replicon | chromosome |
| Accession | NZ_CP097555 | ||
| Organism | Pseudomonas aeruginosa strain B1.2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | M8Z32_RS24760 | Protein ID | WP_003113526.1 |
| Coordinates | 5320785..5321063 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M8Z32_RS24755 | Protein ID | WP_003133769.1 |
| Coordinates | 5320468..5320773 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Z32_RS24725 (M8Z32_24700) | 5315838..5316110 | + | 273 | WP_071538125.1 | DNA-binding protein | - |
| M8Z32_RS24730 (M8Z32_24705) | 5316168..5316749 | + | 582 | WP_123903235.1 | sce7726 family protein | - |
| M8Z32_RS24735 (M8Z32_24710) | 5316736..5317806 | - | 1071 | WP_023098928.1 | beta family protein | - |
| M8Z32_RS24740 (M8Z32_24715) | 5317796..5318632 | - | 837 | WP_079387117.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M8Z32_RS24745 (M8Z32_24720) | 5318625..5319299 | - | 675 | WP_023098926.1 | N-acetyltransferase | - |
| M8Z32_RS24750 (M8Z32_24725) | 5319725..5320132 | - | 408 | WP_049267485.1 | hypothetical protein | - |
| M8Z32_RS24755 (M8Z32_24730) | 5320468..5320773 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| M8Z32_RS24760 (M8Z32_24735) | 5320785..5321063 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8Z32_RS24765 (M8Z32_24740) | 5321116..5321244 | - | 129 | Protein_4891 | integrase | - |
| M8Z32_RS24770 (M8Z32_24745) | 5321392..5323620 | + | 2229 | WP_043089846.1 | TonB-dependent receptor | - |
| M8Z32_RS24775 (M8Z32_24750) | 5323690..5324337 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| M8Z32_RS24780 (M8Z32_24755) | 5324399..5325637 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10614.13 Da Isoelectric Point: 7.8937
>T245569 WP_003113526.1 NZ_CP097555:c5321063-5320785 [Pseudomonas aeruginosa]
VILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
VILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|