Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 1373182..1373783 | Replicon | chromosome |
Accession | NZ_CP097529 | ||
Organism | Pseudomonas putida strain KT2440 isolate pSEVA631 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2L1IAQ2 |
Locus tag | M8Z99_RS06255 | Protein ID | WP_049587984.1 |
Coordinates | 1373469..1373783 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2L1IAR7 |
Locus tag | M8Z99_RS06250 | Protein ID | WP_049587986.1 |
Coordinates | 1373182..1373469 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Z99_RS06230 (M8Z99_06215) | 1368214..1369059 | + | 846 | WP_003254799.1 | DUF6502 family protein | - |
M8Z99_RS06235 (M8Z99_06220) | 1369056..1370774 | + | 1719 | WP_010952348.1 | DUF5666 domain-containing protein | - |
M8Z99_RS06240 (M8Z99_06225) | 1370829..1371578 | + | 750 | WP_049587988.1 | hypothetical protein | - |
M8Z99_RS06245 (M8Z99_06230) | 1371650..1372981 | - | 1332 | WP_004576169.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M8Z99_RS06250 (M8Z99_06235) | 1373182..1373469 | - | 288 | WP_049587986.1 | helix-turn-helix domain-containing protein | Antitoxin |
M8Z99_RS06255 (M8Z99_06240) | 1373469..1373783 | - | 315 | WP_049587984.1 | hypothetical protein | Toxin |
M8Z99_RS06260 (M8Z99_06245) | 1374232..1376142 | + | 1911 | WP_010952353.1 | potassium transporter Kup | - |
M8Z99_RS06265 (M8Z99_06250) | 1376191..1377483 | - | 1293 | WP_010952354.1 | AcvB/VirJ family lysyl-phosphatidylglycerol hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11784.61 Da Isoelectric Point: 9.9097
>T245540 WP_049587984.1 NZ_CP097529:c1373783-1373469 [Pseudomonas putida]
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L1IAQ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L1IAR7 |