Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4750067..4750767 | Replicon | chromosome |
Accession | NZ_CP097528 | ||
Organism | Pseudomonas putida strain KT2440 isolate pMBEC6 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | Q88F93 |
Locus tag | M8003_RS22015 | Protein ID | WP_010954960.1 |
Coordinates | 4750471..4750767 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | I7AUJ7 |
Locus tag | M8003_RS22010 | Protein ID | WP_003254235.1 |
Coordinates | 4750067..4750468 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8003_RS21990 (M8003_21965) | 4745201..4746022 | - | 822 | WP_010954957.1 | transporter substrate-binding domain-containing protein | - |
M8003_RS21995 (M8003_21970) | 4746098..4747027 | - | 930 | WP_010954958.1 | FAD-binding protein | - |
M8003_RS22000 (M8003_21975) | 4747028..4747777 | - | 750 | WP_003254232.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
M8003_RS22005 (M8003_21980) | 4748313..4749995 | + | 1683 | WP_010954959.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
M8003_RS22010 (M8003_21985) | 4750067..4750468 | - | 402 | WP_003254235.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
M8003_RS22015 (M8003_21990) | 4750471..4750767 | - | 297 | WP_010954960.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
M8003_RS22020 (M8003_21995) | 4750862..4752187 | - | 1326 | WP_010954961.1 | MFS transporter | - |
M8003_RS22025 (M8003_22000) | 4752260..4752739 | - | 480 | WP_010954962.1 | hypothetical protein | - |
M8003_RS22030 (M8003_22005) | 4752908..4753384 | - | 477 | WP_010954963.1 | sigma-70 family RNA polymerase sigma factor | - |
M8003_RS22035 (M8003_22010) | 4753597..4754775 | + | 1179 | WP_010954964.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11133.22 Da Isoelectric Point: 10.2271
>T245538 WP_010954960.1 NZ_CP097528:c4750767-4750471 [Pseudomonas putida]
MEKRMPHCPLERVKALAAARRIRPTGAALKGAKALGMDFPGMLEVITSLKRTDFYKSMTSHIDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKEL
MEKRMPHCPLERVKALAAARRIRPTGAALKGAKALGMDFPGMLEVITSLKRTDFYKSMTSHIDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14684.76 Da Isoelectric Point: 4.9531
>AT245538 WP_003254235.1 NZ_CP097528:c4750468-4750067 [Pseudomonas putida]
MRCPICGGSELAPDIQGMPYSYKGEMTVIPEVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNANVVDPSFIASIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
MRCPICGGSELAPDIQGMPYSYKGEMTVIPEVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNANVVDPSFIASIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|