Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 1449221..1450011 | Replicon | chromosome |
| Accession | NZ_CP097528 | ||
| Organism | Pseudomonas putida strain KT2440 isolate pMBEC6 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | Q88NE5 |
| Locus tag | M8003_RS06615 | Protein ID | WP_010952397.1 |
| Coordinates | 1449221..1449688 (-) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | I7C311 |
| Locus tag | M8003_RS06620 | Protein ID | WP_014859917.1 |
| Coordinates | 1449685..1450011 (-) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8003_RS06595 (M8003_06580) | 1444384..1445913 | + | 1530 | WP_010952395.1 | efflux transporter outer membrane subunit | - |
| M8003_RS06600 (M8003_06585) | 1445910..1448087 | + | 2178 | WP_003251716.1 | FUSC family protein | - |
| M8003_RS06605 (M8003_06590) | 1448077..1448277 | + | 201 | WP_003251718.1 | DUF1656 domain-containing protein | - |
| M8003_RS06610 (M8003_06595) | 1448288..1449148 | + | 861 | WP_010952396.1 | HlyD family secretion protein | - |
| M8003_RS06615 (M8003_06600) | 1449221..1449688 | - | 468 | WP_010952397.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| M8003_RS06620 (M8003_06605) | 1449685..1450011 | - | 327 | WP_014859917.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| M8003_RS06625 (M8003_06610) | 1450104..1450550 | - | 447 | WP_010952399.1 | universal stress protein | - |
| M8003_RS06630 (M8003_06615) | 1450824..1451729 | + | 906 | WP_010952400.1 | LysR family transcriptional regulator | - |
| M8003_RS06635 (M8003_06620) | 1451846..1453387 | + | 1542 | WP_010952401.1 | MFS transporter | - |
| M8003_RS06640 (M8003_06625) | 1453416..1454477 | + | 1062 | WP_049587435.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17962.34 Da Isoelectric Point: 9.7963
>T245532 WP_010952397.1 NZ_CP097528:c1449688-1449221 [Pseudomonas putida]
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|