Detailed information of TA system TA245491

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 34783..35053
• Replicon: plasmid unnamed2
• Accession: NZ_CP097432
• Organism: Escherichia coli strain C288

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M8Y68_RS23735
• Protein ID: WP_001372321.1
• Coordinates: 34928..35053 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	34783..34846 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M8Y68_RS23695	29842..30078	+	237	WP_071594222.1	hypothetical protein	-
M8Y68_RS23700	30551..31090	+	540	WP_000290791.1	single-stranded DNA-binding protein	-
M8Y68_RS23705	31153..31386	+	234	WP_000005990.1	DUF905 family protein	-
M8Y68_RS23710	31452..33410	+	1959	WP_023148339.1	ParB/RepB/Spo0J family partition protein	-
M8Y68_RS23715	33465..33899	+	435	WP_000845951.1	conjugation system SOS inhibitor PsiB	-
M8Y68_RS23720	33896..34658	+	763	Protein_37	plasmid SOS inhibition protein A	-
M8Y68_RS23725	34627..34815	-	189	WP_001299721.1	hypothetical protein	-
-	34627..34851	+	225	NuclAT_0	-	-
-	34627..34851	+	225	NuclAT_0	-	-
-	34627..34851	+	225	NuclAT_0	-	-
-	34627..34851	+	225	NuclAT_0	-	-
-	34783..34846	-	64	-	-	Antitoxin
M8Y68_RS23730	34837..34986	+	150	Protein_39	plasmid maintenance protein Mok	-
M8Y68_RS23735	34928..35053	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M8Y68_RS23740	35273..35503	+	231	WP_071587244.1	hypothetical protein	-
M8Y68_RS23745	35501..35674	-	174	Protein_42	hypothetical protein	-
M8Y68_RS23750	35972..36259	+	288	WP_000107537.1	hypothetical protein	-
M8Y68_RS23755	36380..37201	+	822	WP_001234469.1	DUF932 domain-containing protein	-
M8Y68_RS23760	37498..38088	-	591	WP_000252680.1	transglycosylase SLT domain-containing protein	-
M8Y68_RS23765	38421..38804	+	384	WP_053320747.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M8Y68_RS23770	38991..39680	+	690	WP_000283380.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245491 WP_001372321.1 NZ_CP097432:34928-35053 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 64 bp

>AT245491 NZ_CP097432:c34846-34783 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT

Structures

Antitoxin