Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 7482..7746 Replicon plasmid unnamed1
Accession NZ_CP097431
Organism Escherichia coli strain C288

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag M8Y68_RS23045 Protein ID WP_001331364.1
Coordinates 7594..7746 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 7482..7539 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y68_RS23030 (2737) 2737..5028 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
M8Y68_RS23035 (5021) 5021..6091 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
M8Y68_RS23040 (6110) 6110..7318 - 1209 WP_052980401.1 IncI1-type conjugal transfer protein TrbA -
- (7482) 7482..7539 - 58 NuclAT_0 - Antitoxin
- (7482) 7482..7539 - 58 NuclAT_0 - Antitoxin
- (7482) 7482..7539 - 58 NuclAT_0 - Antitoxin
- (7482) 7482..7539 - 58 NuclAT_0 - Antitoxin
M8Y68_RS23045 (7594) 7594..7746 + 153 WP_001331364.1 Hok/Gef family protein Toxin
M8Y68_RS23050 (7818) 7818..8069 - 252 WP_001291964.1 hypothetical protein -
M8Y68_RS24480 (8568) 8568..8663 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
M8Y68_RS23060 (8728) 8728..8904 - 177 WP_001054901.1 hypothetical protein -
M8Y68_RS23065 (9113) 9113..9322 - 210 WP_001140543.1 hemolysin expression modulator Hha -
M8Y68_RS23070 (9420) 9420..10082 - 663 WP_000644794.1 plasmid IncI1-type surface exclusion protein ExcA -
M8Y68_RS23075 (10153) 10153..12321 - 2169 WP_000698368.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IIa / blaTEM-1A - 1..87915 87915


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T245485 WP_001331364.1 NZ_CP097431:7594-7746 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT245485 NZ_CP097431:c7539-7482 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References