Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3701547..3702241 | Replicon | chromosome |
| Accession | NZ_CP097430 | ||
| Organism | Escherichia coli strain C288 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | M8Y68_RS18140 | Protein ID | WP_001263489.1 |
| Coordinates | 3701547..3701945 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | M8Y68_RS18145 | Protein ID | WP_000554758.1 |
| Coordinates | 3701948..3702241 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3697135) | 3697135..3697215 | - | 81 | NuclAT_11 | - | - |
| - (3697135) | 3697135..3697215 | - | 81 | NuclAT_11 | - | - |
| - (3697135) | 3697135..3697215 | - | 81 | NuclAT_11 | - | - |
| - (3697135) | 3697135..3697215 | - | 81 | NuclAT_11 | - | - |
| M8Y68_RS18115 (3697811) | 3697811..3698269 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| M8Y68_RS18120 (3698530) | 3698530..3699987 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| M8Y68_RS18125 (3700044) | 3700044..3700565 | - | 522 | Protein_3563 | peptide chain release factor H | - |
| M8Y68_RS18130 (3700561) | 3700561..3700767 | - | 207 | Protein_3564 | RtcB family protein | - |
| M8Y68_RS18135 (3701085) | 3701085..3701537 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| M8Y68_RS18140 (3701547) | 3701547..3701945 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M8Y68_RS18145 (3701948) | 3701948..3702241 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M8Y68_RS18150 (3702293) | 3702293..3703348 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| M8Y68_RS18155 (3703419) | 3703419..3704204 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| M8Y68_RS18160 (3704176) | 3704176..3705888 | + | 1713 | Protein_3570 | flagellar biosynthesis protein FlhA | - |
| M8Y68_RS18165 (3706112) | 3706112..3706609 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T245481 WP_001263489.1 NZ_CP097430:c3701945-3701547 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |