Detailed information of TA system TA245465

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 59349..59619
• Replicon: plasmid unnamed2
• Accession: NZ_CP097428
• Organism: Escherichia coli strain C289

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M8Y67_RS23785
• Protein ID: WP_001372321.1
• Coordinates: 59494..59619 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	59349..59412 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M8Y67_RS23745	54408..54644	+	237	WP_071594222.1	hypothetical protein	-
M8Y67_RS23750	55117..55656	+	540	WP_000290791.1	single-stranded DNA-binding protein	-
M8Y67_RS23755	55719..55952	+	234	WP_000005990.1	DUF905 family protein	-
M8Y67_RS23760	56018..57976	+	1959	WP_023148339.1	ParB/RepB/Spo0J family partition protein	-
M8Y67_RS23765	58031..58465	+	435	WP_000845951.1	conjugation system SOS inhibitor PsiB	-
M8Y67_RS23770	58462..59224	+	763	Protein_57	plasmid SOS inhibition protein A	-
M8Y67_RS23775	59193..59381	-	189	WP_001299721.1	hypothetical protein	-
-	59193..59417	+	225	NuclAT_0	-	-
-	59193..59417	+	225	NuclAT_0	-	-
-	59193..59417	+	225	NuclAT_0	-	-
-	59193..59417	+	225	NuclAT_0	-	-
-	59349..59412	-	64	-	-	Antitoxin
M8Y67_RS23780	59403..59552	+	150	Protein_59	plasmid maintenance protein Mok	-
M8Y67_RS23785	59494..59619	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M8Y67_RS23790	59839..60069	+	231	WP_071587244.1	hypothetical protein	-
M8Y67_RS23795	60067..60240	-	174	Protein_62	hypothetical protein	-
M8Y67_RS23800	60538..60825	+	288	WP_000107537.1	hypothetical protein	-
M8Y67_RS23805	60946..61767	+	822	WP_001234469.1	DUF932 domain-containing protein	-
M8Y67_RS23810	62064..62666	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
M8Y67_RS23815	62987..63370	+	384	WP_053320747.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M8Y67_RS23820	63557..64246	+	690	WP_000283380.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245465 WP_001372321.1 NZ_CP097428:59494-59619 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 64 bp

>AT245465 NZ_CP097428:c59412-59349 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT

Structures

Antitoxin