Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3693850..3694544 | Replicon | chromosome |
Accession | NZ_CP097426 | ||
Organism | Escherichia coli strain C289 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | M8Y67_RS18090 | Protein ID | WP_001263489.1 |
Coordinates | 3693850..3694248 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | M8Y67_RS18095 | Protein ID | WP_000554758.1 |
Coordinates | 3694251..3694544 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3689438) | 3689438..3689518 | - | 81 | NuclAT_11 | - | - |
- (3689438) | 3689438..3689518 | - | 81 | NuclAT_11 | - | - |
- (3689438) | 3689438..3689518 | - | 81 | NuclAT_11 | - | - |
- (3689438) | 3689438..3689518 | - | 81 | NuclAT_11 | - | - |
M8Y67_RS18065 (3690114) | 3690114..3690572 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
M8Y67_RS18070 (3690833) | 3690833..3692290 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
M8Y67_RS18075 (3692347) | 3692347..3692868 | - | 522 | Protein_3554 | peptide chain release factor H | - |
M8Y67_RS18080 (3692864) | 3692864..3693070 | - | 207 | Protein_3555 | RtcB family protein | - |
M8Y67_RS18085 (3693388) | 3693388..3693840 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
M8Y67_RS18090 (3693850) | 3693850..3694248 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M8Y67_RS18095 (3694251) | 3694251..3694544 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M8Y67_RS18100 (3694596) | 3694596..3695651 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
M8Y67_RS18105 (3695722) | 3695722..3696507 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
M8Y67_RS18110 (3696479) | 3696479..3698191 | + | 1713 | Protein_3561 | flagellar biosynthesis protein FlhA | - |
M8Y67_RS18115 (3698415) | 3698415..3698912 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T245455 WP_001263489.1 NZ_CP097426:c3694248-3693850 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |