Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 760457..761043 Replicon chromosome
Accession NZ_CP097423
Organism Klebsiella pneumoniae strain K153

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M8Y71_RS03550 Protein ID WP_002920800.1
Coordinates 760675..761043 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag M8Y71_RS03545 Protein ID WP_002920802.1
Coordinates 760457..760678 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y71_RS03525 (M8Y71_03525) 756614..757540 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M8Y71_RS03530 (M8Y71_03530) 757537..758814 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
M8Y71_RS03535 (M8Y71_03535) 758811..759578 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M8Y71_RS03540 (M8Y71_03540) 759580..760293 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M8Y71_RS03545 (M8Y71_03545) 760457..760678 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M8Y71_RS03550 (M8Y71_03550) 760675..761043 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M8Y71_RS03555 (M8Y71_03555) 761316..762632 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M8Y71_RS03560 (M8Y71_03560) 762739..763626 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M8Y71_RS03565 (M8Y71_03565) 763623..764468 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M8Y71_RS03570 (M8Y71_03570) 764470..765540 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 757537..766277 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T245426 WP_002920800.1 NZ_CP097423:760675-761043 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT245426 WP_002920802.1 NZ_CP097423:760457-760678 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References