245411

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1508777..1509363 Replicon chromosome
Accession NZ_CP097419
Organism Klebsiella pneumoniae strain K229

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M8Y66_RS07375 Protein ID WP_002920800.1
Coordinates 1508777..1509145 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag M8Y66_RS07380 Protein ID WP_002920802.1
Coordinates 1509142..1509363 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y66_RS07355 (M8Y66_07355) 1504280..1505350 - 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
M8Y66_RS07360 (M8Y66_07360) 1505352..1506197 - 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M8Y66_RS07365 (M8Y66_07365) 1506194..1507081 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M8Y66_RS07370 (M8Y66_07370) 1507188..1508504 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M8Y66_RS07375 (M8Y66_07375) 1508777..1509145 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M8Y66_RS07380 (M8Y66_07380) 1509142..1509363 - 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M8Y66_RS07385 (M8Y66_07385) 1509527..1510240 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M8Y66_RS07390 (M8Y66_07390) 1510242..1511009 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M8Y66_RS07395 (M8Y66_07395) 1511006..1512283 - 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
M8Y66_RS07400 (M8Y66_07400) 1512280..1513206 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1503543..1524131 20588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T245411 WP_002920800.1 NZ_CP097419:c1509145-1508777 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT245411 WP_002920802.1 NZ_CP097419:c1509363-1509142 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References