Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1095171..1095946 | Replicon | chromosome |
| Accession | NZ_CP097419 | ||
| Organism | Klebsiella pneumoniae strain K229 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | M8Y66_RS05195 | Protein ID | WP_004150910.1 |
| Coordinates | 1095171..1095656 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | M8Y66_RS05200 | Protein ID | WP_004150912.1 |
| Coordinates | 1095653..1095946 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Y66_RS05170 (M8Y66_05170) | 1090340..1091707 | - | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
| M8Y66_RS05175 (M8Y66_05175) | 1091700..1092083 | - | 384 | WP_004150906.1 | hypothetical protein | - |
| M8Y66_RS05180 (M8Y66_05180) | 1092083..1092955 | - | 873 | WP_004188557.1 | ParA family protein | - |
| M8Y66_RS05185 (M8Y66_05185) | 1093561..1093777 | - | 217 | Protein_1011 | transposase | - |
| M8Y66_RS05190 (M8Y66_05190) | 1093874..1094467 | - | 594 | WP_004188553.1 | hypothetical protein | - |
| M8Y66_RS05195 (M8Y66_05195) | 1095171..1095656 | - | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| M8Y66_RS05200 (M8Y66_05200) | 1095653..1095946 | - | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| M8Y66_RS05205 (M8Y66_05205) | 1096591..1097967 | + | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| M8Y66_RS05210 (M8Y66_05210) | 1097978..1099126 | + | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| M8Y66_RS05215 (M8Y66_05215) | 1099127..1100038 | - | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| M8Y66_RS05220 (M8Y66_05220) | 1100136..1100738 | + | 603 | WP_002916735.1 | short chain dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Integrative and Conjugative Element | - | - | 1036843..1096197 | 59354 | ||
| flank | IS/Tn | - | - | 1093625..1093777 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T245409 WP_004150910.1 NZ_CP097419:c1095656-1095171 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |