Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 25692..26366 | Replicon | plasmid pKPTCM-3 |
| Accession | NZ_CP097388 | ||
| Organism | Klebsiella pneumoniae strain KPTCM | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LMS5 |
| Locus tag | M6G79_RS26585 | Protein ID | WP_032720638.1 |
| Coordinates | 25692..26015 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M6G79_RS26590 | Protein ID | WP_032720637.1 |
| Coordinates | 26064..26366 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6G79_RS26560 (M6G79_26535) | 20714..22117 | - | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| M6G79_RS26565 (M6G79_26540) | 22229..23761 | + | 1533 | WP_023288255.1 | IS3-like element ISKpn38 family transposase | - |
| M6G79_RS26570 (M6G79_26545) | 24033..24635 | + | 603 | Protein_27 | transposase | - |
| M6G79_RS26575 (M6G79_26550) | 24704..25131 | - | 428 | Protein_28 | DNA-binding protein | - |
| M6G79_RS26580 (M6G79_26555) | 25109..25514 | + | 406 | Protein_29 | DUF4113 domain-containing protein | - |
| M6G79_RS26585 (M6G79_26560) | 25692..26015 | + | 324 | WP_032720638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M6G79_RS26590 (M6G79_26565) | 26064..26366 | + | 303 | WP_032720637.1 | NadS family protein | Antitoxin |
| M6G79_RS26595 (M6G79_26570) | 26409..26576 | - | 168 | WP_153591440.1 | hypothetical protein | - |
| M6G79_RS26600 (M6G79_26575) | 26764..26970 | - | 207 | WP_153591439.1 | hypothetical protein | - |
| M6G79_RS26605 (M6G79_26580) | 26967..27350 | - | 384 | WP_032720636.1 | hypothetical protein | - |
| M6G79_RS26610 (M6G79_26585) | 27455..28027 | - | 573 | WP_032720635.1 | GNAT family N-acetyltransferase | - |
| M6G79_RS26615 (M6G79_26590) | 28029..28841 | - | 813 | WP_223203129.1 | TSUP family transporter | - |
| M6G79_RS26620 (M6G79_26595) | 28853..29773 | - | 921 | WP_050548604.1 | TauD/TfdA family dioxygenase | - |
| M6G79_RS26625 (M6G79_26600) | 30076..30570 | - | 495 | WP_044266755.1 | hypothetical protein | - |
| M6G79_RS26630 (M6G79_26605) | 30601..31173 | - | 573 | WP_044266753.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | qnrB1 / dfrA14 | - | 1..116556 | 116556 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12372.29 Da Isoelectric Point: 9.6240
>T245372 WP_032720638.1 NZ_CP097388:25692-26015 [Klebsiella pneumoniae]
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|