Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5890092..5890687 | Replicon | chromosome |
| Accession | NZ_CP097383 | ||
| Organism | Pseudomonas aeruginosa strain L00-a | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A9E8L6K5 |
| Locus tag | M8G39_RS27875 | Protein ID | WP_071534386.1 |
| Coordinates | 5890409..5890687 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M8G39_RS27870 | Protein ID | WP_003133769.1 |
| Coordinates | 5890092..5890397 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8G39_RS27835 (M8G39_27835) | 5885233..5886081 | + | 849 | WP_009878189.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| M8G39_RS27845 (M8G39_27845) | 5886248..5887189 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| M8G39_RS27850 (M8G39_27850) | 5887306..5887920 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| M8G39_RS27855 (M8G39_27855) | 5887962..5888546 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| M8G39_RS27860 (M8G39_27860) | 5888587..5889687 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| M8G39_RS27870 (M8G39_27870) | 5890092..5890397 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| M8G39_RS27875 (M8G39_27875) | 5890409..5890687 | - | 279 | WP_071534386.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8G39_RS27880 (M8G39_27880) | 5890740..5890862 | - | 123 | Protein_5521 | integrase | - |
| M8G39_RS27885 (M8G39_27885) | 5891010..5893238 | + | 2229 | WP_034005476.1 | TonB-dependent receptor | - |
| M8G39_RS27890 (M8G39_27890) | 5893308..5893955 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| M8G39_RS27895 (M8G39_27895) | 5894017..5895255 | - | 1239 | WP_003111578.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10698.23 Da Isoelectric Point: 7.9184
>T245356 WP_071534386.1 NZ_CP097383:c5890687-5890409 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMHHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMHHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|