Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 90262..90913 | Replicon | plasmid pP14-114 |
| Accession | NZ_CP097382 | ||
| Organism | Providencia stuartii strain P14 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A857SB97 |
| Locus tag | M8G38_RS21785 | Protein ID | WP_042847389.1 |
| Coordinates | 90262..90612 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M8G38_RS21790 | Protein ID | WP_249890904.1 |
| Coordinates | 90614..90913 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8G38_RS21770 (M8G38_21770) | 86072..87022 | - | 951 | WP_249890902.1 | AEC family transporter | - |
| M8G38_RS21775 (M8G38_21775) | 87091..88716 | - | 1626 | WP_249890903.1 | benzoylformate decarboxylase | - |
| M8G38_RS21780 (M8G38_21780) | 89090..89995 | - | 906 | WP_159242422.1 | IS481 family transposase | - |
| M8G38_RS21785 (M8G38_21785) | 90262..90612 | + | 351 | WP_042847389.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8G38_RS21790 (M8G38_21790) | 90614..90913 | + | 300 | WP_249890904.1 | XRE family transcriptional regulator | Antitoxin |
| M8G38_RS21795 (M8G38_21795) | 91096..92397 | - | 1302 | WP_282562167.1 | hypothetical protein | - |
| M8G38_RS21800 (M8G38_21800) | 92529..93728 | - | 1200 | WP_249890886.1 | IS91 family transposase | - |
| M8G38_RS21805 (M8G38_21805) | 93831..94079 | - | 249 | WP_249890906.1 | hypothetical protein | - |
| M8G38_RS21810 (M8G38_21810) | 94232..94969 | - | 738 | WP_249890907.1 | hypothetical protein | - |
| M8G38_RS21815 (M8G38_21815) | 94991..95179 | - | 189 | WP_249890908.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..114876 | 114876 | |
| - | flank | IS/Tn | - | - | 84990..85937 | 947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13437.50 Da Isoelectric Point: 5.2661
>T245349 WP_042847389.1 NZ_CP097382:90262-90612 [Providencia stuartii]
MWEILTRDLFDSWFEEQNEETQIEVLAVLMILREDGPNLGRPQVDTLKGSQFPNMKELRIQVGGHPIRACFAFDPIRRGI
VLCAGDKKGKDETRFYKKLIKMADAEYAAHLLEQEK
MWEILTRDLFDSWFEEQNEETQIEVLAVLMILREDGPNLGRPQVDTLKGSQFPNMKELRIQVGGHPIRACFAFDPIRRGI
VLCAGDKKGKDETRFYKKLIKMADAEYAAHLLEQEK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|