Detailed information of TA system TA245333

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 109698..110124
• Replicon: plasmid pAGR5151
• Accession: NZ_CP097371
• Organism: Escherichia coli strain AGR5151

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M7748_RS23960
• Protein ID: WP_001372321.1
• Coordinates: 109698..109823 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	109900..110124 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M7748_RS23920 (104736)	104736..104963	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
M7748_RS23925 (105057)	105057..105743	-	687	WP_000332487.1	PAS domain-containing protein	-
M7748_RS23930 (105937)	105937..106320	-	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M7748_RS23935 (106615)	106615..107253	+	639	WP_281440555.1	transglycosylase SLT domain-containing protein	-
M7748_RS23940 (107550)	107550..108371	-	822	WP_001234469.1	DUF932 domain-containing protein	-
M7748_RS23945 (108492)	108492..108779	-	288	WP_000107537.1	hypothetical protein	-
M7748_RS23950 (109077)	109077..109250	+	174	Protein_129	hypothetical protein	-
M7748_RS23955 (109248)	109248..109478	-	231	WP_071587244.1	hypothetical protein	-
M7748_RS23960 (109698)	109698..109823	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M7748_RS23965 (109765)	109765..109914	-	150	Protein_132	plasmid maintenance protein Mok	-
- (109900)	109900..110124	-	225	NuclAT_0	-	Antitoxin
- (109900)	109900..110124	-	225	NuclAT_0	-	Antitoxin
- (109900)	109900..110124	-	225	NuclAT_0	-	Antitoxin
- (109900)	109900..110124	-	225	NuclAT_0	-	Antitoxin
M7748_RS23970 (109936)	109936..110124	+	189	WP_001299721.1	hypothetical protein	-
M7748_RS23975 (110093)	110093..110855	-	763	Protein_134	plasmid SOS inhibition protein A	-
M7748_RS23980 (110852)	110852..111286	-	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
M7748_RS23985 (111341)	111341..113299	-	1959	WP_032152921.1	ParB/RepB/Spo0J family partition protein	-
M7748_RS23990 (113358)	113358..113591	-	234	WP_000006018.1	DUF905 domain-containing protein	-
M7748_RS23995 (113647)	113647..114174	-	528	WP_000290793.1	single-stranded DNA-binding protein	-
M7748_RS24000 (114644)	114644..114892	-	249	WP_071606928.1	hypothetical protein	-
M7748_RS24005 (114814)	114814..115044	-	231	WP_001333093.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / aadA5 / dfrA17	senB	1..137735	137735

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T245333 WP_001372321.1 NZ_CP097371:c109823-109698 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT245333 NZ_CP097371:c110124-109900 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin