Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 703679..704406 | Replicon | chromosome |
Accession | NZ_CP097370 | ||
Organism | Escherichia coli strain AGR5151 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | M7748_RS03450 | Protein ID | WP_000550189.1 |
Coordinates | 703679..703993 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M7748_RS03455 | Protein ID | WP_000560269.1 |
Coordinates | 703990..704406 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7748_RS03430 (699836) | 699836..700822 | - | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
M7748_RS03435 (700901) | 700901..701593 | - | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
M7748_RS03440 (701670) | 701670..702173 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
M7748_RS03445 (702258) | 702258..703394 | + | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
M7748_RS03450 (703679) | 703679..703993 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
M7748_RS03455 (703990) | 703990..704406 | + | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
M7748_RS03460 (704451) | 704451..706469 | - | 2019 | WP_000121413.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
M7748_RS03465 (706695) | 706695..709046 | - | 2352 | WP_000695431.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T245317 WP_000550189.1 NZ_CP097370:703679-703993 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT245317 WP_000560269.1 NZ_CP097370:703990-704406 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|