Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 66941..67180 | Replicon | plasmid pAGR6128 |
| Accession | NZ_CP097368 | ||
| Organism | Escherichia coli strain AGR6128 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | M7747_RS24015 | Protein ID | WP_023144756.1 |
| Coordinates | 66941..67075 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 67120..67180 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7747_RS23975 (62288) | 62288..62703 | - | 416 | Protein_74 | IS1-like element IS1B family transposase | - |
| M7747_RS23980 (62952) | 62952..63353 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M7747_RS23985 (63286) | 63286..63543 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M7747_RS23990 (63636) | 63636..64289 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M7747_RS23995 (65229) | 65229..66086 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| M7747_RS24000 (66079) | 66079..66153 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| M7747_RS24010 (66390) | 66390..66644 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| M7747_RS24015 (66941) | 66941..67075 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (67120) | 67120..67180 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (67120) | 67120..67180 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (67120) | 67120..67180 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (67120) | 67120..67180 | + | 61 | NuclAT_0 | - | Antitoxin |
| M7747_RS24020 (67147) | 67147..67433 | - | 287 | Protein_82 | DUF2726 domain-containing protein | - |
| M7747_RS24025 (67511) | 67511..69124 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| M7747_RS24030 (69155) | 69155..69505 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M7747_RS24035 (69502) | 69502..69927 | - | 426 | WP_000422741.1 | transposase | - |
| M7747_RS24040 (70486) | 70486..70698 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| M7747_RS24045 (70829) | 70829..71389 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..122671 | 122671 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T245307 WP_023144756.1 NZ_CP097368:c67075-66941 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT245307 NZ_CP097368:67120-67180 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
