Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3534936..3535615 | Replicon | chromosome |
Accession | NZ_CP097367 | ||
Organism | Escherichia coli strain AGR6128 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | M7747_RS17285 | Protein ID | WP_000057523.1 |
Coordinates | 3535313..3535615 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | M7747_RS17280 | Protein ID | WP_000806442.1 |
Coordinates | 3534936..3535277 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7747_RS17270 (3531180) | 3531180..3532112 | - | 933 | WP_000883041.1 | glutaminase A | - |
M7747_RS17275 (3532374) | 3532374..3534878 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
M7747_RS17280 (3534936) | 3534936..3535277 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
M7747_RS17285 (3535313) | 3535313..3535615 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M7747_RS17290 (3535748) | 3535748..3536542 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
M7747_RS17295 (3536746) | 3536746..3537225 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
M7747_RS17300 (3537249) | 3537249..3538049 | + | 801 | WP_000439798.1 | hypothetical protein | - |
M7747_RS17305 (3538046) | 3538046..3538549 | + | 504 | WP_000667000.1 | hypothetical protein | - |
M7747_RS17310 (3538587) | 3538587..3540239 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T245300 WP_000057523.1 NZ_CP097367:c3535615-3535313 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|