Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 643884..644611 | Replicon | chromosome |
| Accession | NZ_CP097367 | ||
| Organism | Escherichia coli strain AGR6128 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | M7747_RS03190 | Protein ID | WP_000550189.1 |
| Coordinates | 643884..644198 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M7747_RS03195 | Protein ID | WP_000560269.1 |
| Coordinates | 644195..644611 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7747_RS03170 (640041) | 640041..641027 | - | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
| M7747_RS03175 (641106) | 641106..641798 | - | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
| M7747_RS03180 (641875) | 641875..642378 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| M7747_RS03185 (642463) | 642463..643599 | + | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| M7747_RS03190 (643884) | 643884..644198 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| M7747_RS03195 (644195) | 644195..644611 | + | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| M7747_RS03200 (644656) | 644656..646674 | - | 2019 | WP_135097547.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| M7747_RS03205 (646900) | 646900..649251 | - | 2352 | WP_000695431.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T245289 WP_000550189.1 NZ_CP097367:643884-644198 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT245289 WP_000560269.1 NZ_CP097367:644195-644611 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|