Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2986013..2986673 | Replicon | chromosome |
| Accession | NZ_CP097342 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain va18651 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M5K26_RS14440 | Protein ID | WP_045910844.1 |
| Coordinates | 2986320..2986673 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2J0Q4Z7 |
| Locus tag | M5K26_RS14435 | Protein ID | WP_017383313.1 |
| Coordinates | 2986013..2986315 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5K26_RS14420 (M5K26_14400) | 2982183..2983508 | + | 1326 | WP_045910816.1 | SidA/IucD/PvdA family monooxygenase | - |
| M5K26_RS14425 (M5K26_14405) | 2983535..2985724 | + | 2190 | WP_023324924.1 | TonB-dependent siderophore receptor | - |
| M5K26_RS14435 (M5K26_14415) | 2986013..2986315 | - | 303 | WP_017383313.1 | XRE family transcriptional regulator | Antitoxin |
| M5K26_RS14440 (M5K26_14420) | 2986320..2986673 | - | 354 | WP_045910844.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5K26_RS14445 (M5K26_14425) | 2986864..2987814 | - | 951 | WP_003859532.1 | HTH-type transcriptional regulator Cbl | - |
| M5K26_RS14450 (M5K26_14430) | 2987911..2988828 | - | 918 | WP_003859531.1 | nitrogen assimilation transcriptional regulator NAC | - |
| M5K26_RS14460 (M5K26_14440) | 2989319..2990242 | - | 924 | WP_045910845.1 | L,D-transpeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13557.40 Da Isoelectric Point: 9.9193
>T245246 WP_045910844.1 NZ_CP097342:c2986673-2986320 [Enterobacter hormaechei subsp. xiangfangensis]
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLREKGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKFGNERRFYDEMLLVADREYTRWLNTLKERN
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLREKGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKFGNERRFYDEMLLVADREYTRWLNTLKERN
Download Length: 354 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11028.85 Da Isoelectric Point: 6.4727
>AT245246 WP_017383313.1 NZ_CP097342:c2986315-2986013 [Enterobacter hormaechei subsp. xiangfangensis]
MGRTLEQLIADEKPEVVASAQAMATDILLNIHLAELREKVQKTQVDMARALGIKQPTVAVMEKAGRDIKLSSLKRYVEAA
GGKLRLDVELPDGSHYEFVL
MGRTLEQLIADEKPEVVASAQAMATDILLNIHLAELREKVQKTQVDMARALGIKQPTVAVMEKAGRDIKLSSLKRYVEAA
GGKLRLDVELPDGSHYEFVL
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|