Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 248236..248826 | Replicon | chromosome |
| Accession | NZ_CP097341 | ||
| Organism | Alcaligenes faecalis strain DY-8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0A2N9E1 |
| Locus tag | M6D76_RS01110 | Protein ID | WP_035268575.1 |
| Coordinates | 248530..248826 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | M6D76_RS01105 | Protein ID | WP_042484646.1 |
| Coordinates | 248236..248523 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6D76_RS01090 (M6D76_01090) | 244023..245270 | + | 1248 | WP_257112836.1 | D-amino acid dehydrogenase | - |
| M6D76_RS01095 (M6D76_01095) | 245469..246479 | - | 1011 | WP_060186540.1 | acyltransferase family protein | - |
| M6D76_RS01100 (M6D76_01100) | 246758..248125 | + | 1368 | WP_257112837.1 | DNA recombination protein RmuC | - |
| M6D76_RS01105 (M6D76_01105) | 248236..248523 | - | 288 | WP_042484646.1 | HigA family addiction module antitoxin | Antitoxin |
| M6D76_RS01110 (M6D76_01110) | 248530..248826 | - | 297 | WP_035268575.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M6D76_RS01115 (M6D76_01115) | 248961..251525 | - | 2565 | WP_257112838.1 | EAL domain-containing protein | - |
| M6D76_RS01120 (M6D76_01120) | 251703..251981 | + | 279 | WP_009460160.1 | acylphosphatase | - |
| M6D76_RS01125 (M6D76_01125) | 252146..253039 | + | 894 | WP_257112839.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11108.48 Da Isoelectric Point: 9.3459
>T245238 WP_035268575.1 NZ_CP097341:c248826-248530 [Alcaligenes faecalis]
MIKSFRHKGLQAYFETGSKSGIQAKHAVRLQIQLTALHSATQAEDMNAPGWKLHKLSGKNPKGQSVQDHYTISVSGNWRL
TFYFEGEDAVLVDYQDYH
MIKSFRHKGLQAYFETGSKSGIQAKHAVRLQIQLTALHSATQAEDMNAPGWKLHKLSGKNPKGQSVQDHYTISVSGNWRL
TFYFEGEDAVLVDYQDYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|