Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1448886..1449523 Replicon chromosome
Accession NZ_CP097333
Organism Mannheimia haemolytica strain 184

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M3709_RS07130 Protein ID WP_040080900.1
Coordinates 1448886..1449191 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag M3709_RS07135 Protein ID WP_040080901.1
Coordinates 1449203..1449523 (+) Length 107 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3709_RS07095 (M3709_07095) 1445141..1445638 - 498 WP_040080897.1 hypothetical protein -
M3709_RS07100 (M3709_07100) 1446028..1446261 - 234 WP_162839428.1 hypothetical protein -
M3709_RS07105 (M3709_07105) 1446227..1446556 - 330 WP_040080898.1 DUF2570 family protein -
M3709_RS07110 (M3709_07110) 1446557..1447153 - 597 WP_020824120.1 glycoside hydrolase family 19 protein -
M3709_RS07115 (M3709_07115) 1447168..1447527 - 360 WP_165876904.1 phage holin, lambda family -
M3709_RS07120 (M3709_07120) 1447663..1448136 - 474 WP_006251969.1 antiterminator Q family protein -
M3709_RS07125 (M3709_07125) 1448126..1448695 - 570 WP_040080899.1 recombination protein NinG -
M3709_RS07130 (M3709_07130) 1448886..1449191 + 306 WP_040080900.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M3709_RS07135 (M3709_07135) 1449203..1449523 + 321 WP_040080901.1 HigA family addiction module antitoxin Antitoxin
M3709_RS07140 (M3709_07140) 1449590..1450048 + 459 WP_040080902.1 hypothetical protein -
M3709_RS07145 (M3709_07145) 1450102..1451142 - 1041 WP_040080511.1 IS481 family transposase -
M3709_RS07150 (M3709_07150) 1451277..1451738 - 462 WP_020824123.1 DUF1367 family protein -
M3709_RS07155 (M3709_07155) 1451759..1452361 - 603 WP_040080903.1 DNA N-6-adenine-methyltransferase -
M3709_RS07160 (M3709_07160) 1452358..1453005 - 648 WP_032844508.1 replication protein P -
M3709_RS07165 (M3709_07165) 1453005..1453778 - 774 WP_240517759.1 hypothetical protein -
M3709_RS07170 (M3709_07170) 1453775..1453957 - 183 WP_230269038.1 helix-turn-helix domain-containing protein -
M3709_RS07175 (M3709_07175) 1454072..1454515 - 444 WP_006252074.1 YmfL family putative regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1419500..1468891 49391
- flank IS/Tn - - 1450102..1451142 1040


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(8-97)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(4-82)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11995.61 Da        Isoelectric Point: 6.4692

>T245179 WP_040080900.1 NZ_CP097333:1448886-1449191 [Mannheimia haemolytica]
MFNLTEAHFRDEALYRFFQYGEVSRTIPANLTSVLARKLDMINAAEKLNDLRSPPANRLELLEPKQNNVYSIRVNKQYRL
IFKFENNELSDLYLDPHNYDL

Download         Length: 306 bp

Antitoxin


Download         Length: 107 a.a.        Molecular weight: 12089.80 Da        Isoelectric Point: 6.2152

>AT245179 WP_040080901.1 NZ_CP097333:1449203-1449523 [Mannheimia haemolytica]
MMQRKPTPVGEILQEEFLAPLNLKIGDLVEILDVHRNTASNLVNNSCRVSPEMAFKLAKAFDTSPEFWLNLQTATDLWEL
RHNNRFQQSLDSVKAVNHWQGVPAFA

Download         Length: 321 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References