Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 899100..899682 | Replicon | chromosome |
| Accession | NZ_CP097330 | ||
| Organism | Cupriavidus campinensis strain G5 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M5D45_RS04150 | Protein ID | WP_144201665.1 |
| Coordinates | 899100..899378 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5D45_RS04155 | Protein ID | WP_144201663.1 |
| Coordinates | 899392..899682 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D45_RS04130 (M5D45_04130) | 894700..895293 | + | 594 | WP_144201671.1 | DUF1415 domain-containing protein | - |
| M5D45_RS04135 (M5D45_04135) | 895348..896190 | - | 843 | WP_144201669.1 | SAM-dependent methyltransferase | - |
| M5D45_RS04140 (M5D45_04140) | 896452..898065 | + | 1614 | WP_144201667.1 | FapA family protein | - |
| M5D45_RS04145 (M5D45_04145) | 898255..898701 | + | 447 | WP_186296952.1 | response regulator transcription factor | - |
| M5D45_RS04150 (M5D45_04150) | 899100..899378 | + | 279 | WP_144201665.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5D45_RS04155 (M5D45_04155) | 899392..899682 | + | 291 | WP_144201663.1 | HigA family addiction module antitoxin | Antitoxin |
| M5D45_RS04160 (M5D45_04160) | 899985..901385 | + | 1401 | WP_250025113.1 | site-specific integrase | - |
| M5D45_RS04165 (M5D45_04165) | 901416..901757 | - | 342 | WP_250025114.1 | hypothetical protein | - |
| M5D45_RS04170 (M5D45_04170) | 902468..902929 | - | 462 | WP_250025115.1 | hypothetical protein | - |
| M5D45_RS04175 (M5D45_04175) | 903020..903235 | - | 216 | WP_250025116.1 | hypothetical protein | - |
| M5D45_RS04180 (M5D45_04180) | 903718..904140 | + | 423 | WP_250025117.1 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 899100..929480 | 30380 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10419.99 Da Isoelectric Point: 9.8292
>T245171 WP_144201665.1 NZ_CP097330:899100-899378 [Cupriavidus campinensis]
MIRSFAHKGLERFFTTGSTAAIPAMHVKRLRLILALLDEAGSARDMDAPGLRLHALKGDRAELWAVTVQANWRVTFRFEN
GDAHIVNYIDYH
MIRSFAHKGLERFFTTGSTAAIPAMHVKRLRLILALLDEAGSARDMDAPGLRLHALKGDRAELWAVTVQANWRVTFRFEN
GDAHIVNYIDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|