Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1839874..1840474 | Replicon | chromosome |
| Accession | NZ_CP097320 | ||
| Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | M5I08_RS09880 | Protein ID | WP_219066447.1 |
| Coordinates | 1839874..1840155 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | M5I08_RS09885 | Protein ID | WP_219066448.1 |
| Coordinates | 1840187..1840474 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5I08_RS09860 (M5I08_09860) | 1835760..1836446 | - | 687 | WP_219066443.1 | MBL fold metallo-hydrolase | - |
| M5I08_RS09865 (M5I08_09865) | 1836817..1837521 | + | 705 | WP_219066444.1 | hypothetical protein | - |
| M5I08_RS26165 | 1837612..1837743 | + | 132 | WP_255564668.1 | hypothetical protein | - |
| M5I08_RS09870 (M5I08_09870) | 1837830..1839101 | - | 1272 | WP_219066445.1 | RNA-guided endonuclease TnpB family protein | - |
| M5I08_RS09875 (M5I08_09875) | 1839331..1839774 | + | 444 | WP_249763226.1 | hypothetical protein | - |
| M5I08_RS09880 (M5I08_09880) | 1839874..1840155 | + | 282 | WP_219066447.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5I08_RS09885 (M5I08_09885) | 1840187..1840474 | + | 288 | WP_219066448.1 | HigA family addiction module antitoxin | Antitoxin |
| M5I08_RS09890 (M5I08_09890) | 1840491..1841894 | - | 1404 | WP_249763337.1 | DNA methyltransferase | - |
| M5I08_RS09895 (M5I08_09895) | 1842062..1843462 | + | 1401 | WP_219066449.1 | IS1380 family transposase | - |
| M5I08_RS09900 (M5I08_09900) | 1844066..1844425 | - | 360 | Protein_1963 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10690.11 Da Isoelectric Point: 9.5446
>T245128 WP_219066447.1 NZ_CP097320:1839874-1840155 [Candidatus Mycobacterium methanotrophicum]
VIRSFRAKDTEAIWQRRYVKELSPELSRLTYNKLVLINAAESINDLRVPPGNRPEKPSGIRAGQYSVRVNDQWRLCFTWS
TAGAGDVELVDYH
VIRSFRAKDTEAIWQRRYVKELSPELSRLTYNKLVLINAAESINDLRVPPGNRPEKPSGIRAGQYSVRVNDQWRLCFTWS
TAGAGDVELVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|