Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 106009..106601 | Replicon | plasmid pPROV188-1 |
| Accession | NZ_CP097292 | ||
| Organism | Providencia sp. PROV188 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A6L6F789 |
| Locus tag | M5X66_RS18320 | Protein ID | WP_036954335.1 |
| Coordinates | 106323..106601 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5X66_RS18315 | Protein ID | WP_036954329.1 |
| Coordinates | 106009..106323 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5X66_RS18305 (M5X66_18300) | 103671..105047 | - | 1377 | WP_036954325.1 | conjugal transfer pilus assembly protein TraH | - |
| M5X66_RS18310 (M5X66_18305) | 105459..105811 | + | 353 | Protein_77 | transposase | - |
| M5X66_RS18315 (M5X66_18310) | 106009..106323 | - | 315 | WP_036954329.1 | HigA family addiction module antitoxin | Antitoxin |
| M5X66_RS18320 (M5X66_18315) | 106323..106601 | - | 279 | WP_036954335.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5X66_RS18325 (M5X66_18320) | 106645..107217 | - | 573 | WP_282561917.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
| M5X66_RS18330 (M5X66_18325) | 107196..107516 | - | 321 | WP_282561919.1 | hypothetical protein | - |
| M5X66_RS18335 (M5X66_18330) | 107527..108312 | - | 786 | WP_036954346.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
| M5X66_RS18340 (M5X66_18335) | 108258..110153 | - | 1896 | WP_282561920.1 | conjugal transfer protein TraN | - |
| M5X66_RS18345 (M5X66_18340) | 110135..110884 | - | 750 | WP_282561921.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | prgK / prgI / sicA / spaS / spaQ / spaP / invC/sctN / invA / cdtA / cdtC | 1..145399 | 145399 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10857.23 Da Isoelectric Point: 8.4391
>T245113 WP_036954335.1 NZ_CP097292:c106601-106323 [Providencia sp. PROV188]
MIKSFKHKGLKQLFEKGNTSGVPAQDAERINDRLQAIDTANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
MIKSFKHKGLKQLFEKGNTSGVPAQDAERINDRLQAIDTANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|