Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pemK-chpS/PRK09812-ChpS |
Location | 5675444..5676021 | Replicon | chromosome |
Accession | NZ_CP097286 | ||
Organism | Pseudomonas viridiflava strain JACO-C-5 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | M4X66_RS25165 | Protein ID | WP_249583288.1 |
Coordinates | 5675695..5676021 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | - |
Locus tag | M4X66_RS25160 | Protein ID | WP_122445782.1 |
Coordinates | 5675444..5675698 (+) | Length | 85 a.a. |
Genomic Context
Location: 5670968..5672359 (1392 bp)
Type: Others
Protein ID: WP_249583286.1
Type: Others
Protein ID: WP_249583286.1
Location: 5672457..5672858 (402 bp)
Type: Others
Protein ID: WP_057408846.1
Type: Others
Protein ID: WP_057408846.1
Location: 5675444..5675698 (255 bp)
Type: Antitoxin
Protein ID: WP_122445782.1
Type: Antitoxin
Protein ID: WP_122445782.1
Location: 5675695..5676021 (327 bp)
Type: Toxin
Protein ID: WP_249583288.1
Type: Toxin
Protein ID: WP_249583288.1
Location: 5678431..5680428 (1998 bp)
Type: Others
Protein ID: WP_249583290.1
Type: Others
Protein ID: WP_249583290.1
Location: 5673056..5673463 (408 bp)
Type: Others
Protein ID: WP_025995654.1
Type: Others
Protein ID: WP_025995654.1
Location: 5673518..5675200 (1683 bp)
Type: Others
Protein ID: WP_249583287.1
Type: Others
Protein ID: WP_249583287.1
Location: 5675966..5677156 (1191 bp)
Type: Others
Protein ID: WP_249583289.1
Type: Others
Protein ID: WP_249583289.1
Location: 5677177..5678172 (996 bp)
Type: Others
Protein ID: WP_192020852.1
Type: Others
Protein ID: WP_192020852.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4X66_RS25140 | 5670968..5672359 | + | 1392 | WP_249583286.1 | heavy metal sensor histidine kinase | - |
M4X66_RS25145 | 5672457..5672858 | + | 402 | WP_057408846.1 | MAPEG family protein | - |
M4X66_RS25150 | 5673056..5673463 | - | 408 | WP_025995654.1 | DUF1090 domain-containing protein | - |
M4X66_RS25155 | 5673518..5675200 | - | 1683 | WP_249583287.1 | NAD-dependent DNA ligase LigB | - |
M4X66_RS25160 | 5675444..5675698 | + | 255 | WP_122445782.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
M4X66_RS25165 | 5675695..5676021 | + | 327 | WP_249583288.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M4X66_RS25170 | 5675966..5677156 | - | 1191 | WP_249583289.1 | methionine adenosyltransferase | - |
M4X66_RS25175 | 5677177..5678172 | - | 996 | WP_192020852.1 | metalloregulator ArsR/SmtB family transcription factor | - |
M4X66_RS25180 | 5678431..5680428 | + | 1998 | WP_249583290.1 | transketolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11885.55 Da Isoelectric Point: 12.5044
>T245101 WP_249583288.1 NZ_CP097286:5675695-5676021 [Pseudomonas viridiflava]
VKQHGFNRADIVRISLNPTAGREQQRDFRPALVLTPAAYNVSGLAIVAPIIQGGDFARYSGFAVPLGGSGVPNKSPRRLT
SPGAFDDRRRITGRQQRAGRRRGRFFPR
VKQHGFNRADIVRISLNPTAGREQQRDFRPALVLTPAAYNVSGLAIVAPIIQGGDFARYSGFAVPLGGSGVPNKSPRRLT
SPGAFDDRRRITGRQQRAGRRRGRFFPR
Download Length: 327 bp