Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5414720..5415313 | Replicon | chromosome |
Accession | NZ_CP097286 | ||
Organism | Pseudomonas viridiflava strain JACO-C-5 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | M4X66_RS23910 | Protein ID | WP_074454419.1 |
Coordinates | 5414720..5414998 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | M4X66_RS23915 | Protein ID | WP_025993256.1 |
Coordinates | 5415008..5415313 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4X66_RS23885 | 5409847..5410743 | + | 897 | WP_249583195.1 | aspartyl/asparaginyl beta-hydroxylase domain-containing protein | - |
M4X66_RS23890 | 5411417..5411728 | + | 312 | WP_249584765.1 | hypothetical protein | - |
M4X66_RS23895 | 5412159..5412482 | + | 324 | WP_058430394.1 | helix-turn-helix domain-containing protein | - |
M4X66_RS23900 | 5412472..5413779 | + | 1308 | WP_249583196.1 | type II toxin-antitoxin system HipA family toxin | - |
M4X66_RS23905 | 5413810..5414433 | - | 624 | WP_249583197.1 | hypothetical protein | - |
M4X66_RS23910 | 5414720..5414998 | + | 279 | WP_074454419.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4X66_RS23915 | 5415008..5415313 | + | 306 | WP_025993256.1 | HigA family addiction module antitoxin | Antitoxin |
M4X66_RS23920 | 5415337..5415603 | - | 267 | WP_004887407.1 | accessory factor UbiK family protein | - |
M4X66_RS23925 | 5416023..5416361 | + | 339 | WP_002555808.1 | P-II family nitrogen regulator | - |
M4X66_RS23930 | 5416396..5417733 | + | 1338 | WP_004887406.1 | ammonium transporter | - |
M4X66_RS23935 | 5417975..5418400 | + | 426 | WP_025993253.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
M4X66_RS23940 | 5418500..5418829 | + | 330 | WP_004887402.1 | transcriptional regulator SutA | - |
M4X66_RS23945 | 5418908..5419600 | - | 693 | WP_249583198.1 | HAD-IA family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10417.00 Da Isoelectric Point: 7.8920
>T245100 WP_074454419.1 NZ_CP097286:5414720-5414998 [Pseudomonas viridiflava]
MIVSFKCGDTRGLFQHGKTRLWPALKAVAERKLAMLDAAVLLSDLRSPPGNRLEILDGDRRGQHSIRINAQFRICFVWGE
NGPEDVEIVDYH
MIVSFKCGDTRGLFQHGKTRLWPALKAVAERKLAMLDAAVLLSDLRSPPGNRLEILDGDRRGQHSIRINAQFRICFVWGE
NGPEDVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|