Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2443856..2444081 | Replicon | chromosome |
Accession | NZ_CP097262 | ||
Organism | Salmonella enterica subsp. enterica strain B3-6 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | M3N94_RS11880 | Protein ID | WP_000813254.1 |
Coordinates | 2443856..2444011 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2444023..2444081 (+) |
Genomic Context
Location: 2444023..2444081 (59 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 2444438..2445370 (933 bp)
Type: Others
Protein ID: WP_000556390.1
Type: Others
Protein ID: WP_000556390.1
Location: 2445367..2445921 (555 bp)
Type: Others
Protein ID: WP_001033796.1
Type: Others
Protein ID: WP_001033796.1
Location: 2446685..2447152 (468 bp)
Type: Others
Protein ID: WP_001227859.1
Type: Others
Protein ID: WP_001227859.1
Location: 2447537..2447692 (156 bp)
Type: Others
Protein ID: WP_085981757.1
Type: Others
Protein ID: WP_085981757.1
Location: 2448759..2448980 (222 bp)
Type: Others
Protein ID: WP_000560208.1
Type: Others
Protein ID: WP_000560208.1
Location: 2438963..2439244 (282 bp)
Type: Others
Protein ID: WP_000445513.1
Type: Others
Protein ID: WP_000445513.1
Location: 2439234..2439422 (189 bp)
Type: Others
Protein ID: WP_001688615.1
Type: Others
Protein ID: WP_001688615.1
Location: 2439416..2439739 (324 bp)
Type: Others
Protein ID: Protein_2320
Type: Others
Protein ID: Protein_2320
Location: 2441910..2442446 (537 bp)
Type: Others
Protein ID: WP_000640113.1
Type: Others
Protein ID: WP_000640113.1
Location: 2442443..2442733 (291 bp)
Type: Others
Protein ID: WP_000774470.1
Type: Others
Protein ID: WP_000774470.1
Location: 2442733..2443332 (600 bp)
Type: Others
Protein ID: WP_000940751.1
Type: Others
Protein ID: WP_000940751.1
Location: 2443395..2443565 (171 bp)
Type: Others
Protein ID: WP_000734094.1
Type: Others
Protein ID: WP_000734094.1
Location: 2443856..2444011 (156 bp)
Type: Toxin
Protein ID: WP_000813254.1
Type: Toxin
Protein ID: WP_000813254.1
Location: 2446083..2446412 (330 bp)
Type: Others
Protein ID: WP_001676916.1
Type: Others
Protein ID: WP_001676916.1
Location: 2446456..2446503 (48 bp)
Type: Others
Protein ID: Protein_2329
Type: Others
Protein ID: Protein_2329
Location: 2447800..2448321 (522 bp)
Type: Others
Protein ID: WP_000004762.1
Type: Others
Protein ID: WP_000004762.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3N94_RS11845 | 2438963..2439244 | - | 282 | WP_000445513.1 | phage holin family protein | - |
M3N94_RS11850 | 2439234..2439422 | - | 189 | WP_001688615.1 | putative holin | - |
M3N94_RS11855 | 2439416..2439739 | - | 324 | Protein_2320 | tellurite/colicin resistance protein | - |
M3N94_RS11860 | 2441910..2442446 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
M3N94_RS11865 | 2442443..2442733 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
M3N94_RS11870 | 2442733..2443332 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
M3N94_RS11875 | 2443395..2443565 | - | 171 | WP_000734094.1 | hypothetical protein | - |
M3N94_RS11880 | 2443856..2444011 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2444023..2444081 | + | 59 | - | - | Antitoxin |
M3N94_RS11885 | 2444438..2445370 | + | 933 | WP_000556390.1 | hypothetical protein | - |
M3N94_RS11890 | 2445367..2445921 | + | 555 | WP_001033796.1 | hypothetical protein | - |
M3N94_RS11895 | 2446083..2446412 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
M3N94_RS11900 | 2446456..2446503 | - | 48 | Protein_2329 | hypothetical protein | - |
M3N94_RS11905 | 2446685..2447152 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
M3N94_RS11910 | 2447537..2447692 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
M3N94_RS11915 | 2447800..2448321 | - | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
M3N94_RS11920 | 2448759..2448980 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2438421..2450292 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T245077 WP_000813254.1 NZ_CP097262:c2444011-2443856 [Salmonella enterica subsp. enterica]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT245077 NZ_CP097262:2444023-2444081 [Salmonella enterica subsp. enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TMW0 |
Antitoxin
Download structure file