Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5302439..5303034 | Replicon | chromosome |
Accession | NZ_CP097256 | ||
Organism | Pseudomonas aeruginosa strain D5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | M4954_RS24650 | Protein ID | WP_003117425.1 |
Coordinates | 5302756..5303034 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M4954_RS24645 | Protein ID | WP_003099268.1 |
Coordinates | 5302439..5302744 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4954_RS24625 (M4954_24625) | 5297948..5299498 | - | 1551 | WP_071535171.1 | AAA family ATPase | - |
M4954_RS24630 (M4954_24630) | 5299521..5299919 | - | 399 | WP_051428818.1 | ASCH domain-containing protein | - |
M4954_RS24635 (M4954_24635) | 5299897..5300949 | - | 1053 | WP_051428817.1 | hypothetical protein | - |
M4954_RS24640 (M4954_24640) | 5300953..5301483 | - | 531 | WP_071535170.1 | ATP-binding protein | - |
M4954_RS24645 (M4954_24645) | 5302439..5302744 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
M4954_RS24650 (M4954_24650) | 5302756..5303034 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4954_RS24655 (M4954_24655) | 5303087..5303215 | - | 129 | Protein_4877 | integrase | - |
M4954_RS24660 (M4954_24660) | 5303363..5305591 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
M4954_RS24665 (M4954_24665) | 5305661..5306308 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M4954_RS24670 (M4954_24670) | 5306370..5307608 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T245064 WP_003117425.1 NZ_CP097256:c5303034-5302756 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|